TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Rabbit polyclonal anti-H3F3B(Histone H3) antibody, Loading control
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 86 of Histone H3.3B |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
Applications | IF, IHC, IP, WB |
Reactivities | Human (Predicted: Rat, Zebrafish, Xenopus, Pig, Chicken, Sheep, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Anti-ACTN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1 |
Rabbit Polyclonal Anti-ACTN4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ACTN4 |
Rabbit Polyclonal Anti-HIST4H4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HIST4H4 |
Rabbit Polyclonal TNF-alpha Antibody
Applications | FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375] |
Anti-SSB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 100-105 amino acids of human Sjogren syndrome antigen B (autoantigen La) |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
DiMethyl-Histone H3-K9 Rabbit Polyclonal Antibody
Applications | ChIP, ChIP-seq, Dot, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K9 of human histone H3 |
TriMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
Applications | ChIP, ChIP-seq, Dot, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic tri-methylated peptide corresponding to residues surrounding K36 of human histone H3 |
ACTN2 (215-500) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment containing a sequence corresponding to a region within amino acids 215 and 500 of actinin, alpha 2 |
Rabbit anti-TRIM21 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TRIM21 |
MonoMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
Applications | ChIP, ChIP-seq, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
Applications | ChIP, ChIP-seq, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Other (Wide Range) |
Conjugation | Unconjugated |
Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |