Antibodies

Jump to Filters
View as table Download
TBX21 Rabbit Polyclonal Antibody
TA326655

USD 570.00

5 Days

Rabbit Polyclonal TBX21 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TBX21 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human TBX2.
TBX21 Rabbit Polyclonal Antibody
TA330627

USD 539.00

5 Days

Rabbit Polyclonal Anti-TBX21 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the middle region of human TBX21. Synthetic peptide located within the following region: SIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQAKDVVPQAYWL
TBX21 Rabbit Polyclonal Antibody
TA324549

USD 580.00

5 Days

Rabbit polyclonal TBX21 Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TBX21 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 22-50 amino acids from the N-terminal region of human TBX21.
TBX21 Rabbit Monoclonal Antibody [Clone ID: MRQ-46]
TA327741

USD 1,300.00

5 Days

Rabbit Monoclonal T-bet Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
TBX21 Rabbit Polyclonal Antibody
TA329696

USD 485.00

5 Days

Rabbit Polyclonal Anti-TBX21 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the N terminal of human TBX21. Synthetic peptide located within the following region: FYPEPGAQDADERRGGGSLGSPYPGGALVPAPPSRFLGAYAYPPRPQAAG
TBX21 Rabbit Polyclonal Antibody
TA342329

USD 539.00

5 Days

Rabbit Polyclonal Anti-Tbx21 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Tbx21 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGIVEPGCGDMLTGTEPMPSDEGRGPGADQQHRFFYPEPGAQDPTDRRAG
TBX21 Rabbit Polyclonal Antibody
TA342330

USD 485.00

5 Days

Rabbit Polyclonal Anti-TBX21 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the C terminal of mouse TBX21. Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG
TBX21 Rabbit Monoclonal Antibody [Clone ID: MRQ-46]
AM32239SU-N

USD 2,150.00

2 Weeks

TBX21 rabbit monoclonal antibody, clone MRQ-46, Supernatant

Applications IHC
Reactivities Human
Conjugation Unconjugated