Rabbit Polyclonal Antibody against MOP3
Applications | ChIP, FC, ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bacterially expressed human MOP3 (C-terminus). |
Rabbit Polyclonal Antibody against MOP3
Applications | ChIP, FC, ICC/IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bacterially expressed human MOP3 (C-terminus). |
Rabbit Polyclonal DEC1 Antibody
Applications | ChIP, ELISA, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This DEC1 antibody maps to a region between residues 350 and the C-terminus (residue 412) of human Differentially Expressed in Chondrocytes NP_003661.1 (GeneID 8553). |
Rabbit Polyclonal DEC2/SHARP1 Antibody
Applications | IHC, Simple Western, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human PAI1/Serpine 1 protein (between residues 1-75) [UniProt Q9C0J9] |
Rabbit Polyclonal Anti-BHLHB2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-BHLHB2 antibody: synthetic peptide directed towards the middle region of human BHLHB2. Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE |
Rabbit Polyclonal Anti-NR1D1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NR1D1 |
Rabbit Polyclonal Anti-PER2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PER2 |
Rabbit polyclonal anti-Clock antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Clock. |
Rabbit Polyclonal Anti-PER2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PER2 antibody: synthetic peptide directed towards the middle region of human PER2. Synthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ |
SHARP1 (BHLHE41) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide around Lys31 of Human BHLHE41 / BHLHB3 |
Rabbit Polyclonal Antibody against BMAL
Applications | ChIP, Simple Western, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bacterially expressed human BMAL1 |
Rabbit polyclonal antibody to SHARP2 (basic helix-loop-helix domain containing, class B, 2)
Applications | IF, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 81 of SHARP2 (Uniprot ID#O14503) |
Rabbit Polyclonal Anti-ARNTL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF |
Rabbit Polyclonal Anti-ARNTL Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARNTL |
PER3 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
BMAL1 (ARNTL) (569-573) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.569~573 derived from Human BMAL1 |