Rabbit Polyclonal Anti-TRPP1 (PKD2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)ERWESDDAASQISH, corresponding to amino acid residues 914-927 of human TRPP1. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-TRPP1 (PKD2)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)ERWESDDAASQISH, corresponding to amino acid residues 914-927 of human TRPP1. Intracellular, C-terminus. |
Rabbit Polyclonal Vanilloid R1/TRPV1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal portion of the rat TRPV1 protein (between residues 1-50) [UniProt O35433] |
Rabbit Polyclonal Anti-TRPA1 (extracellular)
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)NSTGIINETSDHSE, corresponding to amino acid residues 747-760 of human TRPA1. 1st extracellular loop. |
Rabbit Polyclonal TRPA1 Antibody
Applications | ELISA, FC, ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a region within the N-terminus (residues 1-100) of the human TRPA1 protein. [Swiss-Prot# O75762] |
Rabbit Polyclonal Anti-TRPM4 Antibody
Applications | WB |
Reactivities | Rat, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI |
Rabbit Polyclonal Antibody against TRPM8 (Center R536)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TRPM8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 521-552 amino acids from the Central region of human TRPM8. |
Rabbit Polyclonal Anti-TRPM7
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CKRRKKDKTSDGPKLFLTEE, corresponding to amino acid residues 1146-1165 of human TRPM7. Intracellular, C-terminus. |
Rabbit polyclonal anti-TRPV1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TRPV1 |
Anti-TRPV4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 237-465 amino acids of human transient receptor potential cation channel, subfamily V, member 4 |
Rabbit Polyclonal TRPV4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TRPV4 antibody was raised against an 18 amino acid peptide near the center of human TRPV4. The immunogen is located within amino acids 380 - 430 of TRPV4. |
TRPV2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human, Monkey, Pig, Horse (Predicted: Bovine, Hamster, Rabbit) |
Conjugation | Unconjugated |
Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Horse, Pig (100%); Gibbon, Bovine, Hamster, Panda, Rabbit (93%); Mouse, Dog (87%); Elephant (80%). |
Anti-TRPM5 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1029-1043 amino acids of human transient receptor potential cation channel, subfamily M, member 5 |
Anti-TRPA1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1105-1119 amino acids of human transient receptor potential cation channel, subfamily A, member 1 |
Rabbit Polyclonal TRPM8 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human TRPM8 protein (between residues 250-300) [UniProt Q7Z2W7] |
Rabbit Polyclonal Anti-TRPM2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM2 antibody: synthetic peptide directed towards the N terminal of human TRPM2. Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK |