Rabbit Polyclonal Anti-CACNA1A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CACNA1A |
Rabbit Polyclonal Anti-CACNA1A Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CACNA1A |
Rabbit Polyclonal Anti-KCNB1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNB1 |
Rabbit Polyclonal Anti-ITPR3 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ITPR3 |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
Modifications | Phospho-specific |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Dog, Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 716 and 998 of GNAS (Uniprot ID#Q5JWF2) |
Rabbit polyclonal anti-GluR4 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GluR4. |
Rabbit polyclonal PKA CAT (Ab-197) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
ACCN1 (ASIC2) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 127~156 amino acids from the Center region of human ACCN1 |
Anti-GNAS Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human GNAS complex locus |
Rabbit polyclonal PLCB2 Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PLCB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-202 amino acids from the N-terminal region of human PLCB2. |
Rabbit polyclonal anti-ADCY5/6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6. |
Rabbit polyclonal anti-PRKX antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PRKX. |
ENaC Gamma Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide from human SCNN1G. |
T1R1 / TAS1R1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Bovine, Dog, Gorilla, Human, Pig, Gibbon, Horse (Predicted: Monkey, Mouse, Rat, Hamster, Rabbit) |
Conjugation | Unconjugated |
Immunogen | Synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human TAS1R1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Bovine, Cat, Dog, Elephant, Panda, Horse, Pig (100%); Marmoset, Mouse, Rat, Hamster, Rabbit |
Rabbit Polyclonal Anti-ADCY6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |