Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human (Predicted: Rat, Zebrafish, Xenopus, Pig, Chicken, Sheep, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit Polyclonal antibody to SSA1 (tripartite motif-containing 21)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Pig, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 254 and 475 of SSA1 (Uniprot ID#P19474) |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Zebrafish, Xenopus, Pig, Chicken, Sheep, Bovine, Rhesus Monkey, X. tropicalis, Mouse) |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histone H2A.Z |
Germany
Japan
United Kingdom
China
