ALAD (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human ALAD |
ALAD (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human ALAD |
Rabbit Polyclonal Anti-ALAD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP |
Rabbit Polyclonal Anti-ALAD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: EEMLRPLVEEGLRCVLIFGVPSRVPKDERGSAADSEESPAIEAIHLLRKT |
Rabbit Polyclonal Anti-ALAD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALAD antibody: synthetic peptide directed towards the middle region of human ALAD. Synthetic peptide located within the following region: SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD |
Rabbit Polyclonal Anti-ALAD Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: MPPTSSTPSLSRPGLGQAGKPDTGSHPPPTISTSIFLSCFPTIPLSRPRT |
ALAD Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ALAD |