ALAD Rabbit Polyclonal Antibody

CAT#: TA346242

Rabbit Polyclonal Anti-ALAD Antibody

Product Images

WB Suggested Anti-ALAD Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ALAD antibody: synthetic peptide directed towards the N terminal of human ALAD. Synthetic peptide located within the following region: MPPTSSTPSLSRPGLGQAGKPDTGSHPPPTISTSIFLSCFPTIPLSRPRT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: aminolevulinate dehydratase
• Database Link:
  NP_001003945
  Entrez Gene 210 Human
  UniProt ID P13716
• Background: The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.
• Synonyms: ALADH; aminolevulinate; aminolevulinate dehydratase; dehydratase; delta-; delta-aminolevulinic acid dehydratase; MGC5057; PBGS; porphobilinogen synthase
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Porphyrin and chlorophyll metabolism