Rabbit Polyclonal MUC-1 Antibody
| Applications | FC, ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Rabbit Polyclonal Antibody against LOX
| Applications | ICC/IF, IHC, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Cow |
| Conjugation | Unconjugated |
| Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal LOX propeptide Antibody
| Applications | ICC/IF, IHC, Immunoblotting, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of mouse LOX propeptide (residues 78-115). [UniProt# P28301] |
WNT3 (315-329) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat, Bovine, Bat, Chicken, Equine, Monkey, Porcine, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from an internal region of human WNT3 |
USD 620.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D3E7 (5B6/6), Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal VEGF Antibody (VG76e)
| Applications | ELISA, ICC/IF, IHC, WB |
| Reactivities | Human, Bovine, Porcine, Sheep |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Apolipoprotein H (APOH) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IHC |
| Reactivities | Canine, Human, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified beta2-Glycoprotein-I (beta2GP-I) from human plasma. This protein is also known as apolipoprotein-H. |
Synaptophysin (SYP) mouse monoclonal antibody, clone SP15, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Hamster, Human, Porcine, Rat |
| Conjugation | Unconjugated |
USD 370.00
In Stock
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D4B8
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Porcine |
| Conjugation | Unconjugated |
VIP guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Feline, Guinea Pig, Human, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic Human VIP (Peninsula, #7161). |
CRISP2 (81-93) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Canine, Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to internal sequence amino acids 81-93 of Human CRISP2 (NP_003287.1). |
USD 655.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 5E4/3 (D6C4), Purified
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Porcine, Rat, Bovine |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
