IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IL12A mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ISG15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK |
TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α. |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
IP10 (CXCL10) mouse monoclonal antibody, Azide Free
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ISG15 mouse monoclonal antibody, clone OTI6C8 (formerly 6C8)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
5 Days
TNF mouse monoclonal antibody,clone 1C1, Biotinylated
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Biotin |
TNFA mouse monoclonal antibody,clone OTI5A11
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |