Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Hamster, Goat |
Conjugation | Unconjugated |
Mouse Monoclonal COX IV Antibody
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Hamster, Goat |
Conjugation | Unconjugated |
Rabbit Polyclonal Fatty Acid Synthase/FASN Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat, Chicken, Hamster, Porcine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide, conjugated to KLH, made near the N-terminus of mouse FAS. [Swiss-Prot# P19096] |
Rabbit Polyclonal Antibody against SAT1
Applications | IHC, WB |
Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Rabbit polyclonal PCYT1A Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Hamster) |
Conjugation | Unconjugated |
Immunogen | This PCYT1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-54 amino acids from the N-terminal region of human PCYT1A. |
LIS1 (PAFAH1B1) (397-410) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat, Bat, Chicken, Equine, Hamster, Monkey, Rabbit, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Peptide from (C-term) of the protein sequence according to NP_000421 |
FH (176-189) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Canine, Human, Mouse, Rat, Bovine, Chicken, Drosophila, Equine, Hamster, Insect, Monkey, Porcine, Sheep, Xenopus, Zebrafish |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide from an internal region of human FH |
Rabbit Polyclonal Anti-ATIC Antibody
Applications | WB |
Reactivities | Human, Hamster |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATIC antibody: synthetic peptide directed towards the N terminal of human ATIC. Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG |
Mouse Monoclonal ALDH2 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Monkey, Hamster |
Conjugation | Unconjugated |