GPAA1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 49-77 amino acids from the N-terminal region of human GPAA1 |
GPAA1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 49-77 amino acids from the N-terminal region of human GPAA1 |
PIGA (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region of human PIGA. |
PIGX (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 74-103) of human PIGX. |
PIGN (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 213-243aa) of human PIGN . |
Rabbit Polyclonal Anti-GPAA1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GPAA1 antibody: synthetic peptide directed towards the C terminal of human GPAA1. Synthetic peptide located within the following region: LGSLFLWRELQEAPLSLAEGWQLFLAALAQGVLEHHTYGALLFPLLSLGL |
Rabbit Polyclonal Anti-PIGV Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIGV antibody: synthetic peptide directed towards the N terminal of human PIGV. Synthetic peptide located within the following region: FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE |
Rabbit Polyclonal Anti-PIGT Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIGT antibody: synthetic peptide directed towards the C terminal of human PIGT. Synthetic peptide located within the following region: LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP |
Rabbit Polyclonal Anti-PIGC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIGC antibody: synthetic peptide directed towards the C terminal of human PIGC. Synthetic peptide located within the following region: AVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS |
PIGA Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PIGA |
Rabbit polyclonal anti-PIGX antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PIGX. |
Rabbit Polyclonal Anti-PIGQ Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIGQ antibody: synthetic peptide directed towards the N terminal of human PIGQ. Synthetic peptide located within the following region: PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS |
Rabbit Polyclonal Anti-PIGZ Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIGZ antibody: synthetic peptide directed towards the N terminal of human PIGZ. Synthetic peptide located within the following region: VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY |
Rabbit Polyclonal Anti-PIGF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIGF antibody: synthetic peptide directed towards the N terminal of human PIGF. Synthetic peptide located within the following region: MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF |
Rabbit Polyclonal Anti-PIGK Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PIGK antibody: synthetic peptide directed towards the N terminal of human PIGK. Synthetic peptide located within the following region: SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD |
PIGH (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 1-30aa) of human PIGH. |