PIGT Rabbit Polyclonal Antibody

CAT#: TA341989

Rabbit Polyclonal Anti-PIGT Antibody

Product Images

WB Suggested Anti-PIGT Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Transfected 293T

• 

  Host: Rabbit; Target Name: PIGT; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIGT antibody: synthetic peptide directed towards the C terminal of human PIGT. Synthetic peptide located within the following region: LPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVAAKP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: phosphatidylinositol glycan anchor biosynthesis class T
• Database Link:
  NP_057021
  Entrez Gene 51604 Human
  UniProt ID Q969N2
• Background: This gene encodes a protein that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis.The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins toThe cell surface.This protein is an essential component ofThe multisubunit enzyme, GPI transamidase. GPI transamidase mediates GPI anchoring inThe endoplasmic reticulum, by catalyzingThe transfer of fully assembled GPI units to proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed forThis gene. [provided by RefSeq, May 2012]
• Synonyms: CGI-06; MCAHS3; NDAP; PNH2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycosylphosphatidylinositol(GPI)-anchor biosynthesis, Metabolic pathways