AR Rabbit monoclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
AR Rabbit monoclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
USD 516.00
In Stock
Rabbit monoclonal anti-ER Antibody, clone OTIR3C2
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-RXRA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit Polyclonal NGFI-B alpha/Nur77/NR4A1 Antibody
Applications | ChIP, ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody was developed against a synthetic peptide corresponding to aa 251-266 of human Nak1 (NP_775180). |
Rabbit polyclonal GR (Ab-211) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 211 (N-E-S-P-W). |
Rabbit polyclonal NURR1 (NR4A2) Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse (Predicted: Rat, Bovine) |
Conjugation | Unconjugated |
Immunogen | This NURR1 (NR4A2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human NURR1 (NR4A2). |
Rabbit Polyclonal ERR alpha/NR3B1 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an N-terminal portion of human Estrogen Related Receptor alpha (within residues 1-50). [Swiss-Prot# P11474] |
Rabbit polyclonal Retinoid X Receptor gamma antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody. |
Rabbit polyclonal Nuclear Receptor NR4A1 (Ab-351) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Nuclear Receptor NR4A1 around the phosphorylation site of serine 351 (L-P-SP-K-P). |
Rabbit polyclonal ESRRA Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat) |
Conjugation | Unconjugated |
Immunogen | This ESRRA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-159 amino acids from the Central region of human ESRRA. |
Rabbit Polyclonal Anti-ESRRG Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human (Predicted: Bat, Xenopus, Zebrafish) |
Conjugation | Unconjugated |
Immunogen | ESRRG / ERR Gamma antibody was raised against synthetic 15 amino acid peptide from C-terminus of human ESRRG / ERR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Lizard (100%); Bat, Xenopus, Zebrafish (93%); Stickleback, Medaka, Pufferfish (87%). |
Rabbit Polyclonal Anti-TRIP4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TRIP4 |
Rabbit Polyclonal Anti-ESR2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ESR2 |
Rabbit Polyclonal Anti-NR3C1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NR3C1 |
Rabbit Polyclonal Anti-PGRMC2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PGRMC2 |