Primary Antibodies

View as table Download

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal Antibody against LOX

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Cow
Conjugation Unconjugated
Immunogen A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300

Rabbit Polyclonal LOX propeptide Antibody

Applications ICC/IF, IHC, Immunoblotting, WB
Reactivities Human, Mouse, Rat, Porcine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of mouse LOX propeptide (residues 78-115). [UniProt# P28301]

Rabbit Polyclonal anti-CALR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Monkey, Porcine, Rabbit, Sheep, Hamster, Guinea Pig
Conjugation Unconjugated
Immunogen Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH

Insulin (INS) rabbit polyclonal antibody

Applications IF, IHC
Reactivities Bovine, Porcine, Rat
Conjugation Unconjugated

Chromogranin A (CHGA) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Porcine
Conjugation Unconjugated
Immunogen Synthetic Pancreastatin.

Rabbit Polyclonal Gastrokine 1 Antibody

Applications WB
Reactivities Human, Equine, Porcine, Primate
Conjugation Unconjugated
Immunogen The portions of amino acids range between 100-150 of human GKN1 was used as the immunogen.

Oxytocin neurophysin 1 (OXT) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Porcine
Conjugation Unconjugated
Immunogen Oxytocin conjugated to bovine thyroglobuline

TAC1 rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Fish, Human, Porcine, Rat
Conjugation Unconjugated
Immunogen Substance K / Neurokinin A (Peninsula) conjugated to BSA

ProDynorphin (PDYN) (1-13) rabbit polyclonal antibody, Serum

Applications IHC, R
Reactivities Guinea Pig, Hamster, Human, Monkey, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, YGGFLRRQFKVVT, corresponding to full-length porcine dynorphin B (1-13), conjugated to thyroglobulin.

VIP rabbit polyclonal antibody, Serum

Applications IHC
Reactivities Feline, Fish, Human, Mammalian, Porcine, Rat
Conjugation Unconjugated
Immunogen Purified porcine VIP.