Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-OMA1 Antibody

Applications WB
Reactivities Human, Fish
Conjugation Unconjugated
Immunogen The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA

gamma Tubulin Rabbit polyclonal Antibody

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat, Monkey, Chicken, Hamster, Cow, Dog, Fish, Xenopus
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human Tubulin gamma

Rabbit polyclonal anti-ATR antibody

Applications WB
Reactivities Human, Mouse, Monkey, Dog, Xenopus, Rat, Fish
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein.

Rabbit polyclonal anti-PCNA antibody

Applications WB
Reactivities Human, Monkey, Dog, Mouse, Bovine, Xenopus, Rat, Chicken, Fish
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein.

Acetylcholinesterase rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Fish, Human
Conjugation Unconjugated
Immunogen Highly purified Acetylcholine Esterase from Electrophorus electricus.

Anti-Connexin 35/36 (Ser276) Antibody

Applications IHC, WB
Reactivities Fish, Mouse, Rabbit
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues of perch connexin 35/36 surrounding Ser276, conjugated to keyhole limpet hemocyanin (KLH).

VIP rabbit polyclonal antibody, Serum

Applications IHC
Reactivities Feline, Fish, Human, Mammalian, Porcine, Rat
Conjugation Unconjugated
Immunogen Purified porcine VIP.