G0 Protein alpha (GNAO1) (NM_138736) Human Recombinant Protein
CAT#: TP315437
Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2, 20 µg
View other "G0 Protein alpha" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC215437 protein sequence
Red=Cloning site Green=Tags(s) MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIK KSPLTICFPEYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKNLRG CGLY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_620073 |
Locus ID | 2775 |
UniProt ID | P09471, Q6AWC5, B3KP89, Q8N6I9 |
Cytogenetics | 16q13 |
Refseq Size | 6061 |
Refseq ORF | 1065 |
Synonyms | DEE17; EIEE17; G-ALPHA-o; GNAO; HLA-DQB1; NEDIM |
Summary | The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015] |
Protein Families | Druggable Genome |
Protein Pathways | Long-term depression, Melanogenesis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402819 | GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC408500 | GNAO1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY402819 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1 |
USD 436.00 |
|
LY408500 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2 |
USD 436.00 |
|
PH315437 | GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_620073) |
USD 3,255.00 |
|
PH317958 | GNAO1 MS Standard C13 and N15-labeled recombinant protein (NP_066268) |
USD 3,255.00 |
|
TP317958 | Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review