G0 Protein alpha (GNAO1) (NM_138736) Human Recombinant Protein

CAT#: TP315437M

Recombinant protein of human guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O (GNAO1), transcript variant 2, 100 µg

Product Images

Coomassie blue staining of purified GNAO1 protein (Cat# TP315437). The protein was produced from HEK293T cells transfected with GNAO1 cDNA clone (Cat# RC215437) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215437 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK
  PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC
  FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK
  KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIK
  KSPLTICFPEYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKNLRG
  CGLY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 39.9 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_620073
• Locus ID: 2775
• UniProt ID: P09471, Q6AWC5, B3KP89, Q8N6I9
• Cytogenetics: 16q13
• Refseq Size: 6061
• Refseq ORF: 1065
• Synonyms: DEE17; EIEE17; G-ALPHA-o; GNAO; HLA-DQB1; NEDIM
• Summary: The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]
• Protein Families: Druggable Genome
• Protein Pathways: Long-term depression, Melanogenesis