PPHLN1 (NM_201438) Human Recombinant Protein
CAT#: TP308045
Recombinant protein of human periphilin 1 (PPHLN1), transcript variant 5, 20 µg
View other "PPHLN1" proteins (13)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208045 protein sequence
Red=Cloning site Green=Tags(s) MAYRRDEMWSEGRYEYERIPRERAPPRSHPSDESGYRWTRDDHSASRQPEYRDMRDGFRRKSFYSSHYAR ERSPYKRDNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSYSFHQSQHRKSVRPGASYKRQNEGNPE RDKERPVQSLKTSRDTSPSSGSAVSSSKVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAG STAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVRV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_958846 |
Locus ID | 51535 |
UniProt ID | Q8NEY8 |
Cytogenetics | 12q12 |
Refseq Size | 1338 |
Refseq ORF | 774 |
Synonyms | CR; HSPC206; HSPC232 |
Summary | The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404420 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404422 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404430 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428347 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428349 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404420 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 5 |
USD 436.00 |
|
LY404422 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 4 |
USD 436.00 |
|
LY404430 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 2 |
USD 436.00 |
|
LY428347 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 6 |
USD 436.00 |
|
LY428349 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 8 |
USD 436.00 |
|
PH308045 | PPHLN1 MS Standard C13 and N15-labeled recombinant protein (NP_958846) |
USD 3,255.00 |
|
PH327699 | PPHLN1 MS Standard C13 and N15-labeled recombinant protein (NP_001137261) |
USD 3,255.00 |
|
TP327699 | Purified recombinant protein of Homo sapiens periphilin 1 (PPHLN1), transcript variant 8, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review