PPHLN1 (NM_201438) Human Mass Spec Standard

CAT#: PH308045

PPHLN1 MS Standard C13 and N15-labeled recombinant protein (NP_958846)

Product Images

Coomassie blue staining of purified PPHLN1 protein (Cat# TP308045). The protein was produced from HEK293T cells transfected with PPHLN1 cDNA clone (Cat# RC208045) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC208045
• Predicted MW: 29.8 kDa
• Protein Sequence:
  Sequence Link

  >RC208045 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAYRRDEMWSEGRYEYERIPRERAPPRSHPSDESGYRWTRDDHSASRQPEYRDMRDGFRRKSFYSSHYAR
  ERSPYKRDNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSYSFHQSQHRKSVRPGASYKRQNEGNPE
  RDKERPVQSLKTSRDTSPSSGSAVSSSKVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAG
  STAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVRV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_958846
• RefSeq Size: 1338
• RefSeq ORF: 774
• Synonyms: CR; HSPC206; HSPC232
• Locus ID: 51535
• UniProt ID: Q8NEY8
• Cytogenetics: 12q12
• Summary: The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]