PPHLN1 (NM_201438) Human Mass Spec Standard
CAT#: PH308045
PPHLN1 MS Standard C13 and N15-labeled recombinant protein (NP_958846)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208045 |
Predicted MW | 29.8 kDa |
Protein Sequence |
>RC208045 protein sequence
Red=Cloning site Green=Tags(s) MAYRRDEMWSEGRYEYERIPRERAPPRSHPSDESGYRWTRDDHSASRQPEYRDMRDGFRRKSFYSSHYAR ERSPYKRDNTFFRESPVGRKDSPHSRSGSSVSSRSYSPERSKSYSFHQSQHRKSVRPGASYKRQNEGNPE RDKERPVQSLKTSRDTSPSSGSAVSSSKVLDKPSRLTEKELAEAASKWAAEKLEKSDESNLPEISEYEAG STAPLFTDQPEEPESNTTHGIELFEDSQLTTRSKAIASKTKEIEQVRV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_958846 |
RefSeq Size | 1338 |
RefSeq ORF | 774 |
Synonyms | CR; HSPC206; HSPC232 |
Locus ID | 51535 |
UniProt ID | Q8NEY8 |
Cytogenetics | 12q12 |
Summary | The protein encoded by this gene is one of the several proteins that become sequentially incorporated into the cornified cell envelope during the terminal differentiation of keratinocyte at the outer layers of epidermis. This protein interacts with periplakin, which is known as a precursor of the cornified cell envelope. The cellular localization pattern and insolubility of this protein suggest that it may play a role in epithelial differentiation and contribute to epidermal integrity and barrier formation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404420 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404422 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC404430 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428347 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC428349 | PPHLN1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY404420 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 5 |
USD 436.00 |
|
LY404422 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 4 |
USD 436.00 |
|
LY404430 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 2 |
USD 436.00 |
|
LY428347 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 6 |
USD 436.00 |
|
LY428349 | Transient overexpression lysate of periphilin 1 (PPHLN1), transcript variant 8 |
USD 436.00 |
|
PH327699 | PPHLN1 MS Standard C13 and N15-labeled recombinant protein (NP_001137261) |
USD 3,255.00 |
|
TP308045 | Recombinant protein of human periphilin 1 (PPHLN1), transcript variant 5, 20 µg |
USD 867.00 |
|
TP327699 | Purified recombinant protein of Homo sapiens periphilin 1 (PPHLN1), transcript variant 8, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review