Myosin (MYL4) (NM_001002841) Human Recombinant Protein
CAT#: TP306569
Recombinant protein of human myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 1, 20 µg
View other "Myosin" proteins (8)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206569 protein sequence
Red=Cloning site Green=Tags(s) MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGE MKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLR VFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001002841 |
Locus ID | 4635 |
UniProt ID | P12829 |
Cytogenetics | 17q21.32 |
Refseq Size | 934 |
Refseq ORF | 591 |
Synonyms | ALC1; AMLC; GT1; PRO1957 |
Summary | Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419311 | MYL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424166 | MYL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425089 | MYL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419311 | Transient overexpression lysate of myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 2 |
USD 436.00 |
|
LY424166 | Transient overexpression lysate of myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 1 |
USD 436.00 |
|
PH306569 | MYL4 MS Standard C13 and N15-labeled recombinant protein (NP_001002841) |
USD 3,255.00 |
|
PH313170 | MYL4 MS Standard C13 and N15-labeled recombinant protein (NP_002467) |
USD 3,255.00 |
|
TP313170 | Recombinant protein of human myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review