Myosin (MYL4) (NM_001002841) Human Mass Spec Standard

CAT#: PH306569

MYL4 MS Standard C13 and N15-labeled recombinant protein (NP_001002841)

Product Images

Coomassie blue staining of purified MYL4 protein (Cat# TP306569). The protein was produced from HEK293T cells transfected with MYL4 cDNA clone (Cat# RC206569) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC206569
• Predicted MW: 21.6 kDa
• Protein Sequence:
  Sequence Link

  >RC206569 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGE
  MKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLR
  VFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001002841
• RefSeq Size: 934
• RefSeq ORF: 591
• Synonyms: ALC1; AMLC; GT1; PRO1957
• Locus ID: 4635
• UniProt ID: P12829
• Cytogenetics: 17q21.32
• Summary: Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]