Myosin (MYL4) (NM_001002841) Human Mass Spec Standard
CAT#: PH306569
MYL4 MS Standard C13 and N15-labeled recombinant protein (NP_001002841)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206569 |
Predicted MW | 21.6 kDa |
Protein Sequence |
>RC206569 protein sequence
Red=Cloning site Green=Tags(s) MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGE MKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLR VFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001002841 |
RefSeq Size | 934 |
RefSeq ORF | 591 |
Synonyms | ALC1; AMLC; GT1; PRO1957 |
Locus ID | 4635 |
UniProt ID | P12829 |
Cytogenetics | 17q21.32 |
Summary | Myosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419311 | MYL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC424166 | MYL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425089 | MYL4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY419311 | Transient overexpression lysate of myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 2 |
USD 436.00 |
|
LY424166 | Transient overexpression lysate of myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 1 |
USD 436.00 |
|
PH313170 | MYL4 MS Standard C13 and N15-labeled recombinant protein (NP_002467) |
USD 3,255.00 |
|
TP306569 | Recombinant protein of human myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 1, 20 µg |
USD 867.00 |
|
TP313170 | Recombinant protein of human myosin, light chain 4, alkali; atrial, embryonic (MYL4), transcript variant 2, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review