OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBE2D4 (NM_015983) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302473
Recombinant protein of human ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA810786 UBE2D4 mouse monoclonal antibody,clone OTI1B1 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "UBE2D4 or NM_015983"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202473 representing NM_015983
Red=Cloning site Green=Tags(s)

MAVKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT
TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLARE
WTQKYAM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 16.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_057067
Locus ID 51619
UniProt ID Q9Y2X8
Cytogenetics 7p13
RefSeq Size 1398
RefSeq ORF 441
Synonyms HBUCE1
Summary Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Pathways Ubiquitin mediated proteolysis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "UBE2D4" proteins (4)
SKU Description Size Price
PH302473 UBE2D4 MS Standard C13 and N15-labeled recombinant protein (NP_057067) 10 ug
$3,360.00
LC414273 Lyophilized UBE2D4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414273 Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4) (as WB positive control) 100 ug
$436.00
TP720161 Recombinant protein of human ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4) 10 ug
$160.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products