UBE2D4 (NM_015983) Human Recombinant Protein
CAT#: TP302473
Recombinant protein of human ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4), 20 µg
View other "UBE2D4" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202473 representing NM_015983
Red=Cloning site Green=Tags(s) MAVKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFT TKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLARE WTQKYAM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057067 |
Locus ID | 51619 |
UniProt ID | Q9Y2X8, A0A024RA90 |
Cytogenetics | 7p13 |
Refseq Size | 1398 |
Refseq ORF | 441 |
Synonyms | HBUCE1 |
Summary | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.[UniProtKB/Swiss-Prot Function] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414273 | UBE2D4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY414273 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4) |
USD 436.00 |
|
PH302473 | UBE2D4 MS Standard C13 and N15-labeled recombinant protein (NP_057067) |
USD 3,255.00 |
|
TP720161 | Recombinant protein of human ubiquitin-conjugating enzyme E2D 4 (putative) (UBE2D4) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review