CTBP2 (NM_001329) Human Mass Spec Standard
CAT#: PH324861
CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001320)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224861 |
Predicted MW | 48.8 kDa |
Protein Sequence |
>RC224861 representing NM_001329
Red=Cloning site Green=Tags(s) MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHE KVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTIC HILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYD PYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV AHPSQAPSPNQPTKHGDNREHPNEQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001320 |
RefSeq Size | 2368 |
RefSeq ORF | 1335 |
Locus ID | 1488 |
UniProt ID | P56545 |
Cytogenetics | 10q26.13 |
Summary | This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2014] |
Protein Families | Stem cell - Pluripotency, Stem cell relevant signaling - Wnt Signaling pathway |
Protein Pathways | Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420003 | CTBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC421253 | CTBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LY420003 | Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 1 |
USD 665.00 |
|
LY421253 | Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 3 |
USD 665.00 |
|
PH313339 | CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001077383) |
USD 3,255.00 |
|
TP313339 | Recombinant protein of human C-terminal binding protein 2 (CTBP2), transcript variant 3, 20 µg |
USD 867.00 |
|
TP324861 | Recombinant protein of human C-terminal binding protein 2 (CTBP2), transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review