ErbB 3 (ERBB3) (NM_001005915) Human Mass Spec Standard
CAT#: PH324398
ERBB3 MS Standard C13 and N15-labeled recombinant protein (NP_001005915)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224398 |
Predicted MW | 20.17 kDa |
Protein Sequence |
>RC224398 representing NM_001005915
Red=Cloning site Green=Tags(s) MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGH NADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLT GQFPMVPSGLTPQQAQDWYLLDDDPRLLTLSASSKVPVTLAAV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001005915 |
RefSeq Size | 1050 |
RefSeq ORF | 549 |
Synonyms | c-erbB-3; c-erbB3; ErbB-3; erbB3-S; FERLK; HER3; LCCS2; MDA-BF-1; p45-sErbB3; p85-sErbB3; p180-ErbB3 |
Locus ID | 2065 |
UniProt ID | P21860 |
Cytogenetics | 12q13.2 |
Summary | This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Adult stem cells, Druggable Genome, Protein Kinase, Secreted Protein, Stem cell - Pluripotency, Transmembrane |
Protein Pathways | Calcium signaling pathway, Endocytosis, ErbB signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400725 | ERBB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC423671 | ERBB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425161 | ERBB3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY400725 | Transient overexpression lysate of v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1 |
USD 436.00 |
|
LY423671 | Transient overexpression lysate of v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s |
USD 436.00 |
|
LY425161 | Transient overexpression lysate of v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s |
USD 436.00 |
|
PH309954 | ERBB3 MS Standard C13 and N15-labeled recombinant protein (NP_001973) |
USD 3,255.00 |
|
TP309954 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, 20 µg |
USD 867.00 |
|
TP324398 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant s, 20 µg |
USD 867.00 |
|
TP700010 | Recombinant extracellular domain of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, expressed in human cells |
USD 867.00 |
|
TP700106 | Purified recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
USD 867.00 |
|
TP710089 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 515.00 |
|
TP710091 | Recombinant protein of human v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian) (ERBB3), transcript variant 1, residues 20-643, with C-terminal DDK tag, expressed in sf9, 20ug |
USD 515.00 |
|
TP723990 | Human HER3 Protein, His Tag |
USD 520.00 |
{0} Product Review(s)
Be the first one to submit a review