COASY (NM_025233) Human Mass Spec Standard
CAT#: PH320733
COASY MS Standard C13 and N15-labeled recombinant protein (NP_079509)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220733 |
Predicted MW | 62.1 kDa |
Protein Sequence |
>RC220733 representing NM_025233
Red=Cloning site Green=Tags(s) MAVFRSGLLVLTTPLASLAPRLASILTSAARLVNHTLYVHLQPGMSLEGPAQPQYSPVQATFEVLDFITH LYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQTLDGSQYNPVKQQLVRYATSC YSCCPRLASVLLYSDYGIGEVPVEPLDVPLPSTIRPASPVAGSPKQPVRGYYRGAVGGTFDRLHNAHKVL LSVACILAQEQLVVGVADKDLLKSKLLPELLQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDP SLEFLVVSEETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYE RPELPTCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI INRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAV IPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTH QALD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079509 |
RefSeq Size | 2470 |
RefSeq ORF | 1692 |
Synonyms | DPCK; NBIA6; NBP; PCH12; pOV-2; PPAT; UKR1 |
Locus ID | 80347 |
UniProt ID | Q13057 |
Cytogenetics | 17q21.2 |
Summary | Coenzyme A (CoA) functions as a carrier of acetyl and acyl groups in cells and thus plays an important role in numerous synthetic and degradative metabolic pathways in all organisms. In eukaryotes, CoA and its derivatives are also involved in membrane trafficking and signal transduction. This gene encodes the bifunctional protein coenzyme A synthase (CoAsy) which carries out the last two steps in the biosynthesis of CoA from pantothenic acid (vitamin B5). The phosphopantetheine adenylyltransferase domain of this bifunctional protein catalyzes the conversion of 4'-phosphopantetheine into dephospho-coenzyme A (dpCoA) while its dephospho-CoA kinase domain completes the final step by phosphorylating dpCoA to form CoA. Mutations in this gene are associated with neurodegeneration with brain iron accumulation (NBIA). Alternative splicing results in multiple isoforms. [provided by RefSeq, Apr 2014] |
Protein Pathways | Metabolic pathways, Pantothenate and CoA biosynthesis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403068 | COASY HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC420963 | COASY HEK293T cell transient overexpression lysate (as WB positive control) |
USD 206.00 |
|
LC420964 | COASY HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425766 | COASY HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC425767 | COASY HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY403068 | Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 436.00 |
|
LY420963 | Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2 |
USD 665.00 |
|
LY420964 | Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 436.00 |
|
LY425767 | Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3 |
USD 436.00 |
|
PH309424 | COASY MS Standard C13 and N15-labeled recombinant protein (NP_001035995) |
USD 3,255.00 |
|
PH315228 | COASY MS Standard C13 and N15-labeled recombinant protein (NP_001035994) |
USD 3,255.00 |
|
TP309424 | Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
USD 867.00 |
|
TP315228 | Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
USD 867.00 |
|
TP315287 | Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 5, 20 µg |
USD 867.00 |
|
TP320733 | Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review