COASY (NM_025233) Human Tagged ORF Clone

CAT#: RC220733

Reviews ()
Write a review

COASY (Myc-DDK-tagged)-Human CoA synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1



  "NM_025233" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol COASY
Synonyms DPCK; NBIA6; NBP; PCH12; pOV-2; PPAT; UKR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC220733 representing NM_025233
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGTATTCCGGTCGGGTCTCCTGGTGCTGACGACGCCGCTGGCCTCCCTAGCCCCTCGCCTGGCCT
CCATCCTGACCTCGGCGGCCCGGCTGGTGAATCACACACTCTATGTTCACCTGCAGCCGGGCATGAGCCT
GGAGGGCCCGGCTCAGCCCCAGTACAGCCCCGTGCAGGCCACGTTTGAGGTTCTTGATTTCATCACGCAC
CTCTATGCTGGCGCCGACGTCCACAGGCACTTGGACGTCAGAATCCTACTGACCAATATCCGAACCAAGA
GCACCTTTCTCCCTCCCCTGCCCACCTCAGTCCAGAATCTCGCCCACCCGCCAGAAGTCGTGTTGACAGA
TTTCCAGACCCTGGATGGAAGCCAGTACAACCCGGTCAAACAGCAGCTAGTGCGTTACGCCACCAGCTGT
TACAGCTGTTGTCCGCGACTGGCCTCGGTGCTGCTATACTCCGATTATGGGATAGGAGAAGTGCCCGTGG
AGCCCCTGGATGTCCCCTTACCCTCCACGATCAGGCCAGCTTCCCCCGTGGCCGGGTCTCCAAAGCAGCC
GGTGCGTGGCTACTACCGTGGCGCTGTCGGTGGCACGTTTGACCGCCTGCACAACGCCCACAAGGTGTTG
CTCAGTGTCGCGTGCATCCTGGCCCAGGAGCAGCTTGTGGTGGGAGTAGCAGACAAAGATCTGTTGAAGA
GCAAGTTGCTCCCTGAGCTGCTCCAACCTTATACAGAACGTGTGGAACATCTGAGTGAATTCCTGGTGGA
CATCAAGCCCTCCTTGACTTTTGATGTCATCCCCCTGCTGGACCCCTATGGGCCCGCTGGCTCTGACCCC
TCCCTGGAGTTCCTGGTGGTCAGCGAGGAGACCTATCGTGGGGGGATGGCCATCAACCGCTTCCGCCTTG
AGAATGACCTGGAGGAACTTGCTTTGTACCAGATCCAGCTGCTGAAGGACCTCAGACATACGGAGAATGA
AGAGGACAAAGTCAGCTCCTCCAGCTTCCGCCAGCGAATGTTGGGGAACCTGCTTCGGCCTCCATATGAA
AGGCCAGAGCTCCCCACATGTCTCTATGTAATTGGGCTGACTGGCATCAGTGGCTCTGGGAAGAGCTCAA
TAGCTCAGCGACTGAAGGGCCTGGGGGCGTTTGTCATTGACAGTGACCACCTGGGTCATCGGGCCTATGC
CCCAGGTGGCCCTGCCTACCAGCCTGTGGTGGAGGCCTTTGGAACAGATATTCTCCATAAAGATGGCATC
ATCAACAGGAAGGTCCTAGGCAGCCGGGTGTTTGGGAATAAGAAGCAGCTGAAGATACTCACGGACATTA
TGTGGCCAATTATCGCAAAGCTGGCCCGAGAGGAGATGGATCGGGCTGTGGCTGAGGGAAAGCGTGTGTG
TGTGATTGATGCCGCTGTGTTGCTTGAAGCCGGCTGGCAGAACCTGGTCCATGAGGTGTGGACTGCTGTC
ATCCCAGAGACTGAGGCTGTAAGACGCATTGTGGAGAGGGATGGCCTCAGTGAAGCCGCGGCTCAAAGCC
GGCTGCAGAGCCAGATGAGCGGGCAGCAGCTTGTGGAACAGAGCCACGTGGTGCTCAGCACCTTGTGGGA
GCCGCATATCACCCAACGCCAGGTGGAGAAAGCCTGGGCCCTCTTGCAGAAGCGCATTCCCAAGACTCAT
CAGGCCCTCGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC220733 representing NM_025233
Red=Cloning site Green=Tags(s)

MAVFRSGLLVLTTPLASLAPRLASILTSAARLVNHTLYVHLQPGMSLEGPAQPQYSPVQATFEVLDFITH
LYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQTLDGSQYNPVKQQLVRYATSC
YSCCPRLASVLLYSDYGIGEVPVEPLDVPLPSTIRPASPVAGSPKQPVRGYYRGAVGGTFDRLHNAHKVL
LSVACILAQEQLVVGVADKDLLKSKLLPELLQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDP
SLEFLVVSEETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYE
RPELPTCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI
INRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAV
IPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTH
QALD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025233
ORF Size 1692 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025233.4, NP_079509.4
RefSeq Size 2470 bp
RefSeq ORF 1695 bp
Locus ID 80347
UniProt ID Q13057
Cytogenetics 17q21.2
Domains CoaE, CTP_transf_2
Protein Pathways Metabolic pathways, Pantothenate and CoA biosynthesis
MW 62.1 kDa
Gene Summary Coenzyme A (CoA) functions as a carrier of acetyl and acyl groups in cells and thus plays an important role in numerous synthetic and degradative metabolic pathways in all organisms. In eukaryotes, CoA and its derivatives are also involved in membrane trafficking and signal transduction. This gene encodes the bifunctional protein coenzyme A synthase (CoAsy) which carries out the last two steps in the biosynthesis of CoA from pantothenic acid (vitamin B5). The phosphopantetheine adenylyltransferase domain of this bifunctional protein catalyzes the conversion of 4'-phosphopantetheine into dephospho-coenzyme A (dpCoA) while its dephospho-CoA kinase domain completes the final step by phosphorylating dpCoA to form CoA. Mutations in this gene are associated with neurodegeneration with brain iron accumulation (NBIA). Alternative splicing results in multiple isoforms. [provided by RefSeq, Apr 2014]

Other Versions

Other products for "COASY"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


COASY mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.