CRIP2 (NM_001270841) Human Tagged ORF Clone

CAT#: RG231594

CRIP2 (tGFP-tagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 3

Product Images

Circular map for RG231594

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: TurboGFP
• Symbol: CRIP2
• Synonyms: CRIP; CRP2; ESP1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RG231594 representing NM_001270841
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCCTCCAAATGCCCCAAGTGCGACAAGACCGTGTACTTCGCTGAGAAGGTGACGTCTCTGGGCAAGG
  ATTGGCACCGGCCCTGCCTGCGCTGCGAGCGCTGCGGGAAGACACTGACCCCCGGCGGGCACGCGGAGCA
  CGACGGCCAGCCCTACTGCCACAAGCCCTGCTATGGAATCCTCTTCGGACCCAAGGGAGTGAACACCGGT
  GCGGTGGGCAGCTACATCTATGACCGGGACCCCGAAGGCAAGGTCCAGCCC
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >RG231594 representing NM_001270841
  Red=Cloning site Green=Tags(s)
  
  MASKCPKCDKTVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTG
  AVGSYIYDRDPEGKVQP
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001270841
• ORF Size: 261 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001270841.2
• RefSeq Size: 884 bp
• RefSeq ORF: 264 bp
• Locus ID: 1397
• UniProt ID: P52943
• Cytogenetics: 14q32.33
• Gene Summary: This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]