CPT1C (NM_001136052) Human Tagged ORF Clone

CAT#: RG226726

CPT1C (GFP-tagged) - Human carnitine palmitoyltransferase 1C (CPT1C), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CPT1C (NM_001136052) Human Tagged ORF Clone
Symbol CPT1C
Synonyms CATL1; CPT1-B; CPT1P; CPTI-B; CPTIC; SPG73
Vector pCMV6-AC-GFP
Sequence Data
>RG226726 representing NM_001136052
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGAAGCGCACCAGGCCGTGGGCTTCCGACCCTCGCTGACCTCGGACGGGGCTGAAGTGGAACTCA
GTGCCCCTGTGCTGCAGGAGATCTACCTCTCTGGCCTGCGCTCCTGGAAAAGGCATCTCTCACGTTTCTG
GAATGACTTTCTCACCGGTGTGTTTCCTGCCAGCCCCCTCAGTTGGCTTTTCCTCTTCAGTGCCATCCAG
CTTGCCTGGTTCCTCCAGCTGGATCCTTCCTTAGGACTGATGGAGAAGATCAAAGAGTTGCTGCCTGACT
GGGGTGGACAACACCACGGGCTCCGGGGGGTCCTGGCAGCCGCGCTGTTTGCCTCGTGTTTGTGGGGAGC
CCTGATCTTCACACTGCACGTGGCCCTGAGGCTGCTTCTGTCCTACCACGGCTGGCTTCTTGAGCCCCAC
GGAGCCATGTCCTCCCCCACCAAGACCTGGCTGGCCCTGGTCCGCATCTTCTCTGGCCGCCACCCGATGC
TGTTCAGTTACCAGCGCTCCCTGCCACGCCAGCCCGTGCCCTCTGTGCAGGACACCGTGCGCAAGTACCT
GGAGTCGG[AT]CCGGCCCATCCTCTCCGACGAGGACTTCGACTGGACCGCGGTCCTGGCGCAGGAATTC
CTGAGGCTGCAGGCGTCGCTGCTGCAGTGGTACCTGCGGCTCAAGTCCTGGTGGGCGTCCAATTATGTCA
GTGACTGGTGGGAGGAATTTGTGTACCTGCGCTCCCGAAATCCGCTGATGGTGAACAGCAACTATTACAT
GATGGCAGCTCGCGCTGGGAATGCCGTCCATGCCCTCCTCCTGTACCGCCACCGCCTGAACCGCCAGGAG
ATACCCCCGACTTTGCTGATGGGAATGCGCCCCTTATGCTCTGCCCAGTACGAGAAGATCTTCAACACCA
CGCGGATTCCAGGGGTCCAAAAAGACTACATCCGCCACCTCCATGACAGCCAACACGTGGCTGTCTTCCA
CCGGGGCCGATTCTTCCGCATGGGGACCCACTCCCGAAACAGCCTGCTTTCCCCGAGAGCCCTGGAGCAG
CAGTTTCAGAGAATCCTGGATGATCCCTCACCGGCCTGCCCCCACGAGGAACATCTGGCAGCTCTGACAG
CTGCTCCCAGGGGCACGTGGGCCCAGGTGCGGACATCCCTGAAGACCCAGGCAGCGGAGGCCCTGGAGGC
GGTGGAAGGGGCCGCTTTCTTTGTGTCACTGGATGCTGAGCCCGCGGGGCTCACCAGGGAGGACCCGGCA
GCGTCGTTGGATGCCTACGCCCATGCTCTGCTGGCCGGCCGGGGCCATGATCGCTGGTTTGACAAATCCT
TCACCCTAATCGTCTTCTCTAACGGGAAGCTGGGCCTCAGCGTGGAGCACTCCTGGGCCGACTGCCCCAT
CTCAGGACACATGTGGGAGTTCACTCTGGCTACAGAATGCTTTCAGCTGGGCTACTCAACAGACGGCCAC
TGCAAGGGGCACCCGGACCCCACACTACCCCAGCCCCAGCGGCTGCAATGGGACCTTCCAGACCAGATCC
ACTCCTCCATCTCTCTAGCCCTGAGGGGAGCCAAGATCTTGTCTGAAAATGTCGACTGCCATGTCGTTCC
ATTCTCCCTATTTGGCAAGAGCTTCATCCGACGCTGCCACCTCTCTTCAGACAGCTTCATCCAGATCGCC
TTGCAACTGGCCCACTTCCGGGACAGGGGTCAATTCTGCCTGACTTATGAGTCGGCCATGACTCGCTTAT
TCCTGGAAGGCCGGACGGAGACGGTGCGGTCTTGCACGAGGGAGGCCTGCAACTTTGTCAGGGCCATGGA
GGACAAAGAGAAGACGGACCCACAGTGCCTCGCCCTGTTCCGCGTGGCAGTGGACAAGCACCAGGCTCTG
CTGAAGGCAGCCATGAGCGGGCAGGGAGTTGACCGCCACCTGTTTGCGCTGTACATCGTGTCCCGATTCC
TCCACCTGCAGTCGCCCTTCCTGACCCAGGTCCATTCGGAGCAGTGGCAGCTGTCCACCAGCCAGATCCC
TGTTCAGCAAATGCATCTGTTTGACGTCCACAATTACCCGGACTATGTTTCCTCAGGCGGTGGATTCGGG
CCTGCTGATGACCATGGTTATGGTGTTTCTTATATCTTCATGGGGGATGGCATGATCACCTTCCACATCT
CCAGCAAAAAATCAAGCACAAAAACGGATTCCCACAGGCTGGGGCAGCACATTGAGGACGCACTGCTGGA
TGTGGCCTCCCTGTTCCAGGCGGGACAGCATTTTAAGCGCCGGTTCAGAGGGTCAGGGAAGGAGAACTCC
AGGCACAGGTGTGGATTTCTCTCCCGCCAGACTGGGGCCTCCAAGGCCTCAATGACATCCACCGACTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG226726 representing NM_001136052
Red=Cloning site Green=Tags(s)

MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPLSWLFLFSAIQ
LAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIFTLHVALRLLLSYHGWLLEPH
GAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQDTVRKYLESXXRPILSDEDFDWTAVLAQEF
LRLQASLLQWYLRLKSWWASNYVSDWWEEFVYLRSRNPLMVNSNYYMMAARAGNAVHALLLYRHRLNRQE
IPPTLLMGMRPLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQ
QFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPA
ASLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGHMWEFTLATECFQLGYSTDGH
CKGHPDPTLPQPQRLQWDLPDQIHSSISLALRGAKILSENVDCHVVPFSLFGKSFIRRCHLSSDSFIQIA
LQLAHFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACNFVRAMEDKEKTDPQCLALFRVAVDKHQAL
LKAAMSGQGVDRHLFALYIVSRFLHLQSPFLTQVHSEQWQLSTSQIPVQQMHLFDVHNYPDYVSSGGGFG
PADDHGYGVSYIFMGDGMITFHISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKRRFRGSGKENS
RHRCGFLSRQTGASKASMTSTDF

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001136052
ORF Size 2379 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001136052.2, NP_001129524
RefSeq Size 2853
RefSeq ORF 2379
Locus ID 126129
Cytogenetics 19q13.33
Protein Families Transmembrane, Druggable Genome
Protein Pathways Fatty acid metabolism, PPAR signaling pathway, Adipocytokine signaling pathway
Gene Summary This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein regulates the beta-oxidation and transport of long-chain fatty acids into mitochondria, and may play a role in the regulation of feeding behavior and whole-body energy homeostasis. Alternatively spliced transcript variants encoding multiple protein isoforms have been observed for this gene. [provided by RefSeq, Dec 2010].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)