Aminoadipate aminotransferase (AADAT) (NM_016228) Human Tagged ORF Clone

CAT#: RG223277

Reviews ()
Write a review
  • TrueORF®

AADAT (GFP-tagged) - Human aminoadipate aminotransferase (AADAT), transcript variant 1



  "NM_016228" in other vectors (6)

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Aminoadipate aminotransferase (AADAT) (NM_016228) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol AADAT
Synonyms KAT2; KATII; KYAT2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG223277 representing NM_016228
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATTACGCACGGTTCATCACGGCAGCGAGCGCAGCCAGAAACCCTTCTCCCATCCGGACCATGACTG
ACATATTGAGCAGAGGACCAAAATCGATGATCTCCTTGGCTGGTGGCTTACCAAATCCAAACATGTTTCC
TTTTAAGACTGCCGTAATCACTGTAGAAAATGGAAAGACCATCCAATTTGGAGAAGAGATGATGAAGAGA
GCACTTCAGTATTCTCCGAGTGCTGGAATTCCAGAGCTTTTGTCCTGGCTAAAACAGTTACAAATAAAAT
TGCATAATCCTCCTACCATCCATTACCCACCCAGTCAAGGACAAATGGATCTATGTGTCACATCTGGCAG
CCAACAAGGTCTTTGTAAGGTGTTTGAAATGATCATTAATCCTGGAGATAATGTCCTCCTAGATGAACCT
GCTTATTCAGGAACTCTTCAAAGTCTGCACCCACTGGGCTGCAACATTATTAATGTTGCCAGTGATGAAA
GTGGGATTGTTCCAGATTCCCTAAGAGACATACTTTCCAGATGGAAACCAGAAGATGCAAAGAATCCCCA
GAAAAACACCCCCAAATTTCTTTATACTGTTCCAAATGGCAACAACCCTACTGGAAACTCATTAACCAGT
GAACGCAAAAAGGAAATCTATGAGCTTGCAAGAAAATATGATTTCCTCATAATAGAAGATGATCCTTACT
ATTTTCTCCAGTTTAACAAGTTCAGGGTACCAACATTTCTTTCCATGGATGTTGATGGACGTGTCATCAG
AGCTGACTCTTTTTCAAAAATCATTTCCTCTGGGTTGAGAATAGGATTTTTAACTGGTCCAAAACCCTTA
ATAGAGAGAGTTATTTTACACATACAAGTTTCAACATTGCACCCCAGCACTTTTAACCAGCTCATGATAT
CACAGCTTCTACACGAATGGGGAGAAGAAGGTTTCATGGCTCATGTAGACAGGGTTATTGATTTCTATAG
TAACCAGAAGGATGCAATACTGGCAGCTGCAGACAAGTGGTTAACTGGTTTGGCAGAATGGCATGTTCCT
GCTGCTGGAATGTTTTTATGGATTAAAGTTAAAGGCATTAATGATGTAAAAGAACTGATTGAAGAAAAGG
CCGTTAAGATGGGGGTATTAATGCTCCCTGGAAATGCTTTCTACGTCGATAGCTCAGCTCCTAGCCCTTA
CTTGAGAGCATCCTTCTCTTCAGCTTCTCCAGAACAGATGGATGTGGCCTTCCAGGTATTAGCACAACTT
ATAAAAGAATCTTTA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG223277 representing NM_016228
Red=Cloning site Green=Tags(s)

MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKR
ALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEP
AYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTS
ERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPL
IERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVP
AAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQL
IKESL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_016228
ORF Size 1275 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016228.3, NP_057312.1
RefSeq Size 2326 bp
RefSeq ORF 1278 bp
Locus ID 51166
Cytogenetics 4q33
Protein Pathways Lysine biosynthesis, Lysine degradation, Metabolic pathways, Tryptophan metabolism
Gene Summary This gene encodes a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]

Citations (3)

Other Versions

Other products for "AADAT"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit Polyclonal Anti-AADAT Antibody
    • 100 ul

USD 310.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools