CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone

CAT#: RG218837

Reviews ()
Write a review
  • TrueORF®

ITGAV (GFP-tagged) - Human integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) (ITGAV), transcript variant 1


Product Datasheet for 'RG218837'


 Cited in 4 publications.

  "NM_002210" in other vectors (6)

Need a mutant or fragment? Switch to a different vector? Get a free quote.

USD 1,210.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name CD51 (ITGAV) (NM_002210) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ITGAV
Synonyms CD51; MSK8; VNRA; VTNR
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Cell Selection Neomycin
Sequence Data
>RG218837 representing NM_002210
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTTTCCGCCGCGGCGACGGCTGCGCCTCGGTCCCCGCGGCCTCCCGCTTCTTCTCTCGGGACTCC
TGCTACCTCTGTGCCGCGCCTTCAACCTAGACGTGGACAGTCCTGCCGAGTACTCTGGCCCCGAGGGAAG
TTACTTCGGCTTCGCCGTGGATTTCTTCGTGCCCAGCGCGTCTTCCCGGATGTTTCTTCTCGTGGGAGCT
CCCAAAGCAAACACCACCCAGCCTGGGATTGTGGAAGGAGGGCAGGTCCTCAAATGTGACTGGTCTTCTA
CCCGCCGGTGCCAGCCAATTGAATTTGATGCAACAGGCAATAGAGATTATGCCAAGGATGATCCATTGGA
ATTTAAGTCCCATCAGTGGTTTGGAGCATCTGTGAGGTCGAAACAGGATAAAATTTTGGCCTGTGCCCCA
TTGTACCATTGGAGAACTGAGATGAAACAGGAGCGAGAGCCTGTTGGAACATGCTTTCTTCAAGATGGAA
CAAAGACTGTTGAGTATGCTCCATGTAGATCACAAGATATTGATGCTGATGGACAGGGATTTTGTCAAGG
AGGATTCAGCATTGATTTTACTAAAGCTGACAGAGTACTTCTTGGTGGTCCTGGTAGCTTTTATTGGCAA
GGTCAGCTTATTTCGGATCAAGTGGCAGAAATCGTATCTAAATACGACCCCAATGTTTACAGCATCAAGT
ATAATAACCAATTAGCAACTCGGACTGCACAAGCTATTTTTGATGACAGCTATTTGGGTTATTCTGTGGC
TGTCGGAGATTTCAATGGTGATGGCATAGATGACTTTGTTTCAGGAGTTCCAAGAGCAGCAAGGACTTTG
GGAATGGTTTATATTTATGATGGGAAGAACATGTCCTCCTTATACAATTTTACTGGCGAGCAGATGGCTG
CATATTTCGGATTTTCTGTAGCTGCCACTGACATTAATGGAGATGATTATGCAGATGTGTTTATTGGAGC
ACCTCTCTTCATGGATCGTGGCTCTGATGGCAAACTCCAAGAGGTGGGGCAGGTCTCAGTGTCTCTACAG
AGAGCTTCAGGAGACTTCCAGACGACAAAGCTGAATGGATTTGAGGTCTTTGCACGGTTTGGCAGTGCCA
TAGCTCCTTTGGGAGATCTGGACCAGGATGGTTTCAATGATATTGCAATTGCTGCTCCATATGGGGGTGA
AGATAAAAAAGGAATTGTTTATATCTTCAATGGAAGATCAACAGGCTTGAACGCAGTCCCATCTCAAATC
CTTGAAGGGCAGTGGGCTGCTCGAAGCATGCCACCAAGCTTTGGCTATTCAATGAAAGGAGCCACAGATA
TAGACAAAAATGGATATCCAGACTTAATTGTAGGAGCTTTTGGTGTAGATCGAGCTATCTTATACAGGGC
CAGACCAGTTATCACTGTAAATGCTGGTCTTGAAGTGTACCCTAGCATTTTAAATCAAGACAATAAAACC
TGCTCACTGCCTGGAACAGCTCTCAAAGTTTCCTGTTTTAATGTTAGGTTCTGCTTAAAGGCAGATGGCA
AAGGAGTACTTCCCAGGAAACTTAATTTCCAGGTGGAACTTCTTTTGGATAAACTCAAGCAAAAGGGAGC
AATTCGACGAGCACTGTTTCTCTACAGCAGGTCCCCAAGTCACTCCAAGAACATGACTATTTCAAGGGGG
GGACTGATGCAGTGTGAGGAATTGATAGCGTATCTGCGGGATGAATCTGAATTTAGAGACAAACTCACTC
CAATTACTATTTTTATGGAATATCGGTTGGATTATAGAACAGCTGCTGATACAACAGGCTTGCAACCCAT
TCTTAACCAGTTCACGCCTGCTAACATTAGTCGACAGGCTCACATTCTACTTGACTGTGGTGAAGACAAT
GTCTGTAAACCCAAGCTGGAAGTTTCTGTAGATAGTGATCAAAAGAAGATCTATATTGGGGATGACAACC
CTCTGACATTGATTGTTAAGGCTCAGAATCAAGGAGAAGGTGCCTACGAAGCTGAGCTCATCGTTTCCAT
TCCACTGCAGGCTGATTTCATCGGGGTTGTCCGAAACAATGAAGCCTTAGCAAGACTTTCCTGTGCATTT
AAGACAGAAAACCAAACTCGCCAGGTGGTATGTGACCTTGGAAACCCAATGAAGGCTGGAACTCAACTCT
TAGCTGGTCTTCGTTTCAGTGTGCACCAGCAGTCAGAGATGGATACTTCTGTGAAATTTGACTTACAAAT
CCAAAGCTCAAATCTATTTGACAAAGTAAGCCCAGTTGTATCTCACAAAGTTGATCTTGCTGTTTTAGCT
GCAGTTGAGATAAGAGGAGTCTCGAGTCCTGATCATATCTTTCTTCCGATTCCAAACTGGGAGCACAAGG
AGAACCCTGAGACTGAAGAAGATGTTGGGCCAGTTGTTCAGCACATCTATGAGCTGAGAAACAATGGTCC
AAGTTCATTCAGCAAGGCAATGCTCCATCTTCAGTGGCCTTACAAATATAATAATAACACTCTGTTGTAT
ATCCTTCATTATGATATTGATGGACCAATGAACTGCACTTCAGATATGGAGATCAACCCTTTGAGAATTA
AGATCTCATCTTTGCAAACAACTGAAAAGAATGACACGGTTGCCGGGCAAGGTGAGCGGGACCATCTCAT
CACTAAGCGGGATCTTGCCCTCAGTGAAGGAGATATTCACACTTTGGGTTGTGGAGTTGCTCAGTGCTTG
AAGATTGTCTGCCAAGTTGGGAGATTAGACAGAGGAAAGAGTGCAATCTTGTACGTAAAGTCATTACTGT
GGACTGAGACTTTTATGAATAAAGAAAATCAGAATCATTCCTATTCTCTGAAGTCGTCTGCTTCATTTAA
TGTCATAGAGTTTCCTTATAAGAATCTTCCAATTGAGGATATCACCAACTCCACATTGGTTACCACTAAT
GTCACCTGGGGCATTCAGCCAGCGCCCATGCCTGTGCCTGTGTGGGTGATCATTTTAGCAGTTCTAGCAG
GATTGTTGCTACTGGCTGTTTTGGTATTTGTAATGTACAGGATGGGCTTTTTTAAACGGGTCCGGCCACC
TCAAGAAGAACAAGAAAGGGAGCAGCTTCAACCTCATGAAAATGGTGAAGGAAACTCAGAAACT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG218837 representing NM_002210
Red=Cloning site Green=Tags(s)

MAFPPRRRLRLGPRGLPLLLSGLLLPLCRAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSASSRMFLLVGA
PKANTTQPGIVEGGQVLKCDWSSTRRCQPIEFDATGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAP
LYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSQDIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQ
GQLISDQVAEIVSKYDPNVYSIKYNNQLATRTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTL
GMVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQ
RASGDFQTTKLNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQI
LEGQWAARSMPPSFGYSMKGATDIDKNGYPDLIVGAFGVDRAILYRARPVITVNAGLEVYPSILNQDNKT
CSLPGTALKVSCFNVRFCLKADGKGVLPRKLNFQVELLLDKLKQKGAIRRALFLYSRSPSHSKNMTISRG
GLMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAADTTGLQPILNQFTPANISRQAHILLDCGEDN
VCKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPLQADFIGVVRNNEALARLSCAF
KTENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSHKVDLAVLA
AVEIRGVSSPDHIFLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLHLQWPYKYNNNTLLY
ILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCL
KIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTN
VTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_002210
ORF Size 3144 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002210.2, NP_002201.1
RefSeq Size 7047
RefSeq ORF 3147
Locus ID 3685
Cytogenetics 2q32.1
Domains FG-GAP
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cell adhesion molecules (CAMs), Dilated cardiomyopathy, ECM-receptor interaction, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Pathways in cancer, Regulation of actin cytoskeleton, Small cell lung cancer
Gene Summary The product of this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha subunit and a beta subunit that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha V subunit. This subunit associates with beta 1, beta 3, beta 5, beta 6 and beta 8 subunits. The heterodimer consisting of alpha V and beta 3 subunits is also known as the vitronectin receptor. This integrin may regulate angiogenesis and cancer progression. Alternative splicing results in multiple transcript variants. Note that the integrin alpha 5 and integrin alpha V subunits are encoded by distinct genes. [provided by RefSeq, Oct 2015]

Citations (4)

Other Versions

Other products for "ITGAV"
Frequently bought together (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 640.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 310.00


Rabbit Monoclonal antibody against CD51 / Integrin alpha-V (ITGAV)
    • 100 ul

USD 516.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools