CTBP1 (NM_001012614) Human Tagged ORF Clone

CAT#: RG208594

CTBP1 (GFP-tagged) - Human C-terminal binding protein 1 (CTBP1), transcript variant 2

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CTBP1 (NM_001012614) Human Tagged ORF Clone
Symbol CTBP1
Synonyms BARS
Vector pCMV6-AC-GFP
Sequence Data
>RG208594 representing NM_001012614
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGGCGTCCGACCTCCGATCATGAACGGGCCCCTGCACCCGCGGCCCCTGGTGGCATTGCTGGATG
GCCGGGACTGCACAGTGGAGATGCCCATCCTGAAGGACGTGGCCACTGTGGCCTTCTGCGACGCGCAGTC
CACGCAGGAGATCCATGAGAAGGTCCTGAACGAGGCTGTGGGGGCCCTGATGTACCACACCATCACTCTC
ACCAGGGAGGACCTGGAGAAGTTCAAAGCCCTCCGCATCATCGTCCGGATTGGCAGTGGTTTTGACAACA
TCGACATCAAGTCGGCCGGGGATTTAGGCATTGCCGTCTGCAACGTGCCCGCGGCGTCTGTGGAGGAGAC
GGCCGACTCGACGCTGTGCCACATCCTGAACCTGTACCGGCGGGCCACCTGGCTGCACCAGGCGCTGCGG
GAGGGCACACGAGTCCAGAGCGTCGAGCAGATCCGCGAGGTGGCGTCCGGCGCTGCCAGGATCCGCGGGG
AGACCTTGGGCATCATCGGACTTGGTCGCGTGGGGCAGGCAGTGGCGCTGCGGGCCAAGGCCTTCGGCTT
CAACGTGCTCTTCTACGACCCTTACTTGTCGGATGGCGTGGAGCGGGCGCTGGGGCTGCAGCGTGTCAGC
ACCCTGCAGGACCTGCTCTTCCACAGCGACTGCGTGACCCTGCACTGCGGCCTCAACGAGCACAACCACC
ACCTCATCAACGACTTCACCGTCAAGCAGATGAGACAAGGGGCCTTCCTGGTGAACACAGCCCGGGGTGG
CCTGGTGGATGAGAAGGCGCTGGCCCAGGCCCTGAAGGAGGGCCGGATCCGCGGCGCGGCCCTGGATGTG
CACGAGTCGGAACCCTTCAGCTTTAGCCAGGGCCCTCTGAAGGATGCACCCAACCTCATCTGCACCCCCC
ATGCTGCATGGTACAGCGAGCAGGCATCCATCGAGATGCGAGAGGAGGCGGCACGGGAGATCCGCAGAGC
CATCACAGGCCGGATCCCAGACAGCCTGAAGAACTGTGTCAACAAGGACCATCTGACAGCCGCCACCCAC
TGGGCCAGCATGGACCCCGCCGTCGTGCACCCTGAGCTCAATGGGGCTGCCTATAGGTACCCTCCGGGCG
TGGTGGGCGTGGCCCCCACTGGCATCCCAGCTGCTGTGGAAGGTATCGTCCCCAGCGCCATGTCCCTGTC
CCACGGCCTGCCCCCTGTGGCCCACCCGCCCCACGCCCCTTCTCCTGGCCAAACCGTCAAGCCCGAGGCG
GATAGAGACCACGCCAGTGACCAGTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG208594 representing NM_001012614
Red=Cloning site Green=Tags(s)

MSGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAVGALMYHTITL
TREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADSTLCHILNLYRRATWLHQALR
EGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVS
TLQDLLFHSDCVTLHCGLNEHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDV
HESEPFSFSQGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATH
WASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEA
DRDHASDQL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001012614
ORF Size 1287 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001012614.1, NP_001012632
RefSeq Size 2483
RefSeq ORF 1290
Locus ID 1487
Cytogenetics 4p16.3
Protein Pathways Wnt signaling pathway, Notch signaling pathway, Pathways in cancer, Chronic myeloid leukemia
Gene Summary This gene encodes a protein that binds to the C-terminus of adenovirus E1A proteins. This phosphoprotein is a transcriptional repressor and may play a role during cellular proliferation. This protein and the product of a second closely related gene, CTBP2, can dimerize. Both proteins can also interact with a polycomb group protein complex which participates in regulation of gene expression during development. Alternative splicing of transcripts from this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)