Myosin Light Chain 2 (MYL2) (NM_000432) Human Tagged ORF Clone

CAT#: RG205932

  • TrueORF®

MYL2 (tGFP-tagged) - Human myosin, light chain 2, regulatory, cardiac, slow (MYL2)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_000432" in other vectors (6)

Reconstitution Protocol

USD 350.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


Rabbit anti-MYL2 (Myosin light chain 2, Phospho-Ser18) polyclonal antibody(Phospho-specific)
    • 100 ug

USD 565.00

Other products for "Myosin Light Chain 2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol Myosin Light Chain 2
Synonyms CMH10; MLC-2s/v; MLC2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG205932 representing NM_000432
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCACCTAAGAAAGCAAAGAAGAGAGCCGGGGGCGCCAACTCCAACGTGTTCTCCATGTTCGAACAGA
CCCAAATCCAGGAATTTAAGGAGGCCTTCACTATCATGGACCAGAACAGGGATGGCTTCATTGACAAGAA
CGATCTGAGAGACACCTTTGCTGCCCTTGGGCGAGTGAACGTGAAAAATGAAGAAATTGATGAAATGATC
AAGGAGGCTCCGGGTCCAATTAACTTTACTGTGTTCCTCACAATGTTTGGGGAGAAACTTAAGGGAGCGG
ACCCTGAGGAAACCATTCTCAACGCATTCAAAGTGTTTGACCCTGAAGGCAAAGGGGTGCTGAAGGCTGA
TTACGTTCGGGAAATGCTGACCACGCAGGCGGAGAGGTTTTCCAAGGAGGAGGTTGACCAGATGTTCGCC
GCCTTCCCCCCTGACGTGACTGGCAACTTGGACTACAAGAACCTGGTGCACATCATCACCCACGGAGAAG
AGAAGGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG205932 representing NM_000432
Red=Cloning site Green=Tags(s)

MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMI
KEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFA
AFPPDVTGNLDYKNLVHIITHGEEKD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_000432
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_000432.4
RefSeq Size 813 bp
RefSeq ORF 501 bp
Locus ID 4633
UniProt ID P10916
Cytogenetics 12q24.11
Domains EFh
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Focal adhesion, Hypertrophic cardiomyopathy (HCM), Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Tight junction
Gene Summary Thus gene encodes the regulatory light chain associated with cardiac myosin beta (or slow) heavy chain. Ca+ triggers the phosphorylation of regulatory light chain that in turn triggers contraction. Mutations in this gene are associated with mid-left ventricular chamber type hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.