CD34 (NM_001025109) Human Tagged ORF Clone

CAT#: RG204446

CD34 (GFP-tagged) - Human CD34 molecule (CD34), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 546.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CD34 (NM_001025109) Human Tagged ORF Clone
Symbol CD34
Synonyms CD34 antigen; OTTHUMP00000034733; OTTHUMP00000034734; hematopoietic progenitor cell antigen CD34; CD34 molecule
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG204446 representing NM_001025109
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGTCCGCAGGGGCGCGCGCGCAGGGCCCAGGATGCCGCGGGGCTGGACCGCGCTTTGCTTGCTGA
GTTTGCTGCCTTCTGGGTTCATGAGTCTTGACAACAACGGTACTGCTACCCCAGAGTTACCTACCCAGGG
AACATTTTCAAATGTTTCTACAAATGTATCCTACCAAGAAACTACAACACCTAGTACCCTTGGAAGTACC
AGCCTGCACCCTGTGTCTCAACATGGCAATGAGGCCACAACAAACATCACAGAAACGACAGTCAAATTCA
CATCTACCTCTGTGATAACCTCAGTTTATGGAAACACAAACTCTTCTGTCCAGTCACAGACCTCTGTAAT
CAGCACAGTGTTCACCACCCCAGCCAACGTTTCAACTCCAGAGACAACCTTGAAGCCTAGCCTGTCACCT
GGAAATGTTTCAGACCTTTCAACCACTAGCACTAGCCTTGCAACATCTCCCACTAAACCCTATACATCAT
CTTCTCCTATCCTAAGTGACATCAAGGCAGAAATCAAATGTTCAGGCATCAGAGAAGTGAAATTGACTCA
GGGCATCTGCCTGGAGCAAAATAAGACCTCCAGCTGTGCGGAGTTTAAGAAGGACAGGGGAGAGGGCCTG
GCCCGAGTGCTGTGTGGGGAGGAGCAGGCTGATGCTGATGCTGGGGCCCAGGTATGCTCCCTGCTCCTTG
CCCAGTCTGAGGTGAGGCCTCAGTGTCTACTGCTGGTCTTGGCCAACAGAACAGAAATTTCCAGCAAACT
CCAACTTATGAAAAAGCACCAATCTGACCTGAAAAAGCTGGGGATCCTAGATTTCACTGAGCAAGATGTT
GCAAGCCACCAGAGCTATTCCCAAAAGACCCTGATTGCACTGGTCACCTCGGGAGCCCTGCTGGCTGTCT
TGGGCATCACTGGCTATTTCCTGATGAATCGCCGCAGCTGGAGCCCCACAGGAGAAAGGCTGGGCGAAGA
CCCTTATTACACGGAAAACGGTGGAGGCCAGGGCTATAGCTCAGGACCTGGGACCTCCCCTGAGGCTCAG
GGAAAGGCCAGTGTGAACCGAGGGGCTCAGGAAAACGGGACCGGCCAGGCCACCTCCAGAAACGGCCATT
CAGCAAGACAACACGTGGTGGCTGATACCGAATTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG204446 representing NM_001025109
Red=Cloning site Green=Tags(s)

MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGST
SLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSP
GNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGL
ARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDV
ASHQSYSQKTLIALVTSGALLAVLGITGYFLMNRRSWSPTGERLGEDPYYTENGGGQGYSSGPGTSPEAQ
GKASVNRGAQENGTGQATSRNGHSARQHVVADTEL

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001025109
ORF Size 1155 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001025109.1, NP_001020280
RefSeq Size 2621
RefSeq ORF 1158
Locus ID 947
Cytogenetics 1q32.2
Protein Families ES Cell Differentiation/IPS, Transmembrane, Adult stem cells, Cancer stem cells, Embryonic stem cells, Druggable Genome
Protein Pathways Cell adhesion molecules (CAMs), Hematopoietic cell lineage
Gene Summary Possible adhesion molecule with a role in early hematopoiesis by mediating the attachment of stem cells to the bone marrow extracellular matrix or directly to stromal cells. Could act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. Presents carbohydrate ligands to selectins. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)