G protein coupled receptor 30(GPER1) (NM_001039966) Human Tagged ORF Clone

CAT#: RG203027

GPER (GFP-tagged) - Human G protein-coupled estrogen receptor 1 (GPER), transcript variant 3

Change vector?

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name G protein coupled receptor 30(GPER1) (NM_001039966) Human Tagged ORF Clone
Symbol GPER1
Synonyms CEPR; CMKRL2; DRY12; FEG-1; GPCR-Br; GPER; GPR30; LERGU; LERGU2; LyGPR; mER
Vector pCMV6-AC-GFP
Sequence Data
ORF Nucleotide Sequence
>RG203027 representing NM_001039966
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGTGACTTCCCAAGCCCGGGGCGTGGGCCTGGAGATGTACCTAGGCACCGCGCAGCCTGCGGCCC
CCAACACCACCTCCCCCGAGCTCAACCTGTCCCACCCGCTCCTGGGCACCGCCCTGGCCAATGGGACAGG
TGAGCTCTCGGAGCACCAGCAGTACGTGATCGGCCTGTTCCTCTCGTGCCTCTACACCATCTTCCTCTTC
CCCATCGGCTTTGTGGGCAACATCCTGATCCTGGTGGTGAACATCAGCTTCCGCGAGAAGATGACCATCC
CCGACCTGTACTTCATCAACCTGGCGGTGGCGGACCTCATCCTGGTGGCCGACTCCCTCATTGAGGTGTT
CAACCTGCACGAGCGGTACTACGACATCGCCGTCCTGTGCACCTTCATGTCGCTCTTCCTGCAGGTCAAC
ATGTACAGCAGCGTCTTCTTCCTCACCTGGATGAGCTTCGACCGCTACATCGCCCTGGCCAGGGCCATGC
GCTGCAGCCTGTTCCGCACCAAGCACCACGCCCGGCTGAGCTGTGGCCTCATCTGGATGGCATCCGTGTC
AGCCACGCTGGTGCCCTTCACCGCCGTGCACCTGCAGCACACCGACGAGGCCTGCTTCTGTTTCGCGGAT
GTCCGGGAGGTGCAGTGGCTCGAGGTCACGCTGGGCTTCATCGTGCCCTTCGCCATCATCGGCCTGTGCT
ACTCCCTCATTGTCCGGGTGCTGGTCAGGGCGCACCGGCACCGTGGGCTGCGGCCCCGGCGGCAGAAGGC
GCTCCGCATGATCCTCGCGGTGGTGCTGGTCTTCTTCGTCTGCTGGCTGCCGGAGAACGTCTTCATCAGC
GTGCACCTCCTGCAGCGGACGCAGCCTGGGGCCGCTCCCTGCAAGCAGTCTTTCCGCCATGCCCACCCCC
TCACGGGCCACATTGTCAACCTCGCCGCCTTCTCCAACAGCTGCCTAAACCCCCTCATCTACAGCTTTCT
CGGGGAGACCTTCAGGGACAAGCTGAGGCTGTACATTGAGCAGAAAACAAATTTGCCGGCCCTGAACCGC
TTCTGTCACGCTGCCCTGAAGGCCGTCATTCCAGACAGCACTGAGCAGTCGGATGTGAGGTTCAGCAGTG
CCGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG203027 representing NM_001039966
Red=Cloning site Green=Tags(s)

MDVTSQARGVGLEMYLGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLF
PIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVN
MYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFAD
VREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFIS
VHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNR
FCHAALKAVIPDSTEQSDVRFSSAV

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001039966
ORF Size 1125 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001039966.1, NP_001035055
RefSeq Size 2981
Locus ID 2852
Cytogenetics 7p22.3
Protein Families GPCR, Transmembrane, Druggable Genome
Gene Summary This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.