Annexin A10 (ANXA10) (NM_007193) Human Tagged ORF Clone

CAT#: RG200268

Reviews ()
Write a review
  • TrueORF®

ANXA10 (GFP-tagged) - Human annexin A10 (ANXA10)



  "NM_007193" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 517.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol ANXA10
Synonyms ANX14
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG200268 representing NM_007193
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTTGTGGAGACTATGTGCAAGGAACCATCTTCCCAGCTCCCAATTTCAATCCCATAATGGATGCCC
AAATGCTAGGAGGAGCACTCCAAGGATTTGACTGTGACAAAGACATGCTGATCAACATTCTGACTCAGCG
CTGCAATGCACAAAGGATGATGATTGCAGAGGCATACCAGAGCATGTATGGCCGGGACCTGATTGGGGAT
ATGAGGGAGCAGCTTTCGGATCACTTCAAAGATGTGATGGCTGGCCTCATGTACCCACCACCACTGTATG
ATGCTCATGAGCTCTGGCATGCCATGAAGGGAGTAGGCACTGATGAGAATTGCCTCATTGAAATACTAGC
TTCAAGAACAAATGGAGAAATTTTCCAGATGCGAGAAGCCTACTGCTTGCAATACAGCAATAACCTCCAA
GAGGACATTTATTCAGAGACCTCAGGACACTTCAGAGATACTCTCATGAACTTGGTCCAGGGGACCAGAG
AGGAAGGATATACAGACCCTGCGATGGCTGCTCAGGATGCAATGGTCCTATGGGAAGCCTGTCAGCAGAA
GACGGGGGAGCACAAAACCATGCTGCAAATGATCCTGTGCAACAAGAGCTACCAGCAGCTGCGGCTGGTT
TTCCAGGAATTTCAAAATATTTCTGGGCAAGATATGGTAGATGCCATTAATGAATGTTATGATGGATACT
TTCAGGAGCTGCTGGTTGCAATTGTTCTCTGTGTTCGAGACAAACCAGCCTATTTTGCTTATAGATTATA
TAGTGCAATTCATGACTTTGGTTTCCATAATAAAACTGTAATCAGGATTCTCATTGCCAGAAGTGAAATA
GACCTGCTGACCATAAGGAAACGATACAAAGAGCGATATGGAAAATCCCTATTTCATGATATCAGAAATT
TTGCTTCAGGGCATTATAAGAAAGCACTGCTTGCCATCTGTGCTGGTGATGCTGAGGACTAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG200268 representing NM_007193
Red=Cloning site Green=Tags(s)

MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGD
MREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQ
EDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLV
FQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEI
DLLTIRKRYKERYGKSLFHDIRNFASGHYKKALLAICAGDAEDY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007193
ORF Size 972 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007193.5
RefSeq Size 1428 bp
RefSeq ORF 975 bp
Locus ID 11199
UniProt ID Q9UJ72
Cytogenetics 4q32.3
Gene Summary This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been determined. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "ANXA10"
Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 704.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 385.00


Anti-ANXA10 (Annexin A10) mouse monoclonal antibody, clone OTI4D8 (formerly 4D8)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.