FGF12 (NM_021032) Human Tagged ORF Clone

CAT#: RC215868

FGF12 (Myc-DDK-tagged)-Human fibroblast growth factor 12 (FGF12), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FGF12 (NM_021032) Human Tagged ORF Clone
Symbol FGF12
Synonyms FGF12B; FHF1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC215868 representing NM_021032
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCGGCGATAGCCAGCTCCTTGATCCGGCAGAAGCGGCAGGCGAGGGAGTCCAACAGCGACCGAG
TGTCGGCCTCCAAGCGCCGCTCCAGCCCCAGCAAAGACGGGCGCTCCCTGTGCGAGAGGCACGTCCTCGG
GGTGTTCAGCAAAGTGCGCTTCTGCAGCGGCCGCAAGAGGCCGGTGAGGCGGAGACCAGAACCCCAGCTC
AAAGGGATTGTGACAAGGTTATTCAGCCAGCAGGGATACTTCCTGCAGATGCACCCAGATGGTACCATTG
ATGGGACCAAGGACGAAAACAGCGACTACACTCTCTTCAATCTAATTCCCGTGGGCCTGCGTGTAGTGGC
CATCCAAGGAGTGAAGGCTAGCCTCTATGTGGCCATGAATGGTGAAGGCTATCTCTACAGTTCAGATGTT
TTCACTCCAGAATGCAAATTCAAGGAATCTGTGTTTGAAAACTACTATGTGATCTATTCTTCCACACTGT
ACCGCCAGCAAGAATCAGGCCGAGCTTGGTTTCTGGGACTCAATAAAGAAGGTCAAATTATGAAGGGGAA
CAGAGTGAAGAAAACCAAGCCCTCATCACATTTTGTACCGAAACCTATTGAAGTGTGTATGTACAGAGAA
CCATCGCTACATGAAATTGGAGAAAAACAAGGGCGTTCAAGGAAAAGTTCTGGAACACCAACCATGAATG
GAGGCAAAGTTGTGAATCAAGATTCAACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215868 representing NM_021032
Red=Cloning site Green=Tags(s)

MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQL
KGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDV
FTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYRE
PSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021032
ORF Size 729 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021032.1, NM_021032.2, NM_021032.3, NM_021032.4, NP_066360
RefSeq Size 2817
RefSeq ORF 732
Locus ID 2257
Cytogenetics 3q28-q29
Domains FGF
Protein Families Secreted Protein
Protein Pathways MAPK signaling pathway, Regulation of actin cytoskeleton, Pathways in cancer, Melanoma
MW 27.2 kDa
Gene Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. Two alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)