FGF12 (NM_021032) Human Tagged ORF Clone

CAT#: RG215868

  • TrueORF®

FGF12 (tGFP-tagged) - Human fibroblast growth factor 12 (FGF12), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_021032" in other vectors (6)

Reconstitution Protocol

USD 500.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 750.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 412.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


FGF12 Rabbit polyclonal Antibody
    • 100 ul

USD 365.00

Other products for "FGF12"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Symbol FGF12
Synonyms DEE47; EIEE47; FGF12B; FHF1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG215868 representing NM_021032
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCGGCGATAGCCAGCTCCTTGATCCGGCAGAAGCGGCAGGCGAGGGAGTCCAACAGCGACCGAG
TGTCGGCCTCCAAGCGCCGCTCCAGCCCCAGCAAAGACGGGCGCTCCCTGTGCGAGAGGCACGTCCTCGG
GGTGTTCAGCAAAGTGCGCTTCTGCAGCGGCCGCAAGAGGCCGGTGAGGCGGAGACCAGAACCCCAGCTC
AAAGGGATTGTGACAAGGTTATTCAGCCAGCAGGGATACTTCCTGCAGATGCACCCAGATGGTACCATTG
ATGGGACCAAGGACGAAAACAGCGACTACACTCTCTTCAATCTAATTCCCGTGGGCCTGCGTGTAGTGGC
CATCCAAGGAGTGAAGGCTAGCCTCTATGTGGCCATGAATGGTGAAGGCTATCTCTACAGTTCAGATGTT
TTCACTCCAGAATGCAAATTCAAGGAATCTGTGTTTGAAAACTACTATGTGATCTATTCTTCCACACTGT
ACCGCCAGCAAGAATCAGGCCGAGCTTGGTTTCTGGGACTCAATAAAGAAGGTCAAATTATGAAGGGGAA
CAGAGTGAAGAAAACCAAGCCCTCATCACATTTTGTACCGAAACCTATTGAAGTGTGTATGTACAGAGAA
CCATCGCTACATGAAATTGGAGAAAAACAAGGGCGTTCAAGGAAAAGTTCTGGAACACCAACCATGAATG
GAGGCAAAGTTGTGAATCAAGATTCAACA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG215868 representing NM_021032
Red=Cloning site Green=Tags(s)

MAAAIASSLIRQKRQARESNSDRVSASKRRSSPSKDGRSLCERHVLGVFSKVRFCSGRKRPVRRRPEPQL
KGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDV
FTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYRE
PSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST

TRTRPLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021032
ORF Size 729 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021032.5
RefSeq Size 2817 bp
RefSeq ORF 732 bp
Locus ID 2257
UniProt ID P61328
Cytogenetics 3q28-q29
Domains FGF
Protein Families Secreted Protein
Protein Pathways MAPK signaling pathway, Melanoma, Pathways in cancer, Regulation of actin cytoskeleton
Gene Summary The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. This growth factor lacks the N-terminal signal sequence present in most of the FGF family members, but it contains clusters of basic residues that have been demonstrated to act as a nuclear localization signal. When transfected into mammalian cells, this protein accumulated in the nucleus, but was not secreted. The specific function of this gene has not yet been determined. [provided by RefSeq, Dec 2019]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.