KAT2B (NM_003884) Human Tagged ORF Clone

CAT#: RC209821

Reviews ()
Write a review

KAT2B (Myc-DDK-tagged)-Human K(lysine) acetyltransferase 2B (KAT2B)



Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KAT2B
Synonyms CAF; P/CAF; PCAF
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC209821 representing NM_003884
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGAGGCTGGCGGGGCCGGGCCGGGCGGCTGCGGGGCAGGAGCCGGGGCAGGGGCCGGGCCCGGGG
CGCTGCCCCCGCAGCCTGCGGCGCTTCCGCCCGCGCCCCCGCAGGGCTCCCCCTGCGCCGCTGCCGCCGG
GGGCTCGGGCGCCTGCGGTCCGGCGACGGCAGTGGCTGCAGCGGGCACGGCCGAAGGACCGGGAGGCGGT
GGCTCGGCCCGAATCGCCGTGAAGAAAGCGCAACTACGCTCCGCTCCGCGGGCCAAGAAACTGGAGAAAC
TCGGAGTGTACTCCGCCTGCAAGGCCGAGGAGTCTTGTAAATGTAATGGCTGGAAAAACCCTAACCCCTC
ACCCACTCCCCCCAGAGCCGACCTGCAGCAAATAATTGTCAGTCTAACAGAATCCTGTCGGAGTTGTAGC
CATGCCCTAGCTGCTCATGTTTCCCACCTGGAGAATGTGTCAGAGGAAGAAATGAACAGACTCCTGGGAA
TAGTATTGGATGTGGAATATCTCTTTACCTGTGTCCACAAGGAAGAAGATGCAGATACCAAACAAGTTTA
TTTCTATCTATTTAAGCTCTTGAGAAAGTCTATTTTACAAAGAGGAAAACCTGTGGTTGAAGGCTCTTTG
GAAAAGAAACCCCCATTTGAAAAACCTAGCATTGAACAGGGTGTGAATAACTTTGTGCAGTACAAATTTA
GTCACCTGCCAGCAAAAGAAAGGCAAACAATAGTTGAGTTGGCAAAAATGTTCCTAAACCGCATCAACTA
TTGGCATCTGGAGGCACCATCTCAACGAAGACTGCGATCTCCCAATGATGATATTTCTGGATACAAAGAG
AACTACACAAGGTGGCTGTGTTACTGCAACGTGCCACAGTTCTGCGACAGTCTACCTCGGTACGAAACCA
CACAGGTGTTTGGGAGAACATTGCTTCGCTCGGTCTTCACTGTTATGAGGCGACAACTCCTGGAACAAGC
AAGACAGGAAAAAGATAAACTGCCTCTTGAAAAACGAACTCTAATCCTCACTCATTTCCCAAAATTTCTG
TCCATGCTAGAAGAAGAAGTATATAGTCAAAACTCTCCCATCTGGGATCAGGATTTTCTCTCAGCCTCTT
CCAGAACCAGCCAGCTAGGCATCCAAACAGTTATCAATCCACCTCCTGTGGCTGGGACAATTTCATACAA
TTCAACCTCATCTTCCCTTGAGCAGCCAAACGCAGGGAGCAGCAGTCCTGCCTGCAAAGCCTCTTCTGGA
CTTGAGGCAAACCCAGGAGAAAAGAGGAAAATGACTGATTCTCATGTTCTGGAGGAGGCCAAGAAACCCC
GAGTTATGGGGGATATTCCGATGGAATTAATCAACGAGGTTATGTCTACCATCACGGACCCTGCAGCAAT
GCTTGGACCAGAGACCAATTTTCTGTCAGCACACTCGGCCAGGGATGAGGCGGCAAGGTTGGAAGAGCGC
AGGGGTGTAATTGAATTTCACGTGGTTGGCAATTCCCTCAACCAGAAACCAAACAAGAAGATCCTGATGT
GGCTGGTTGGCCTACAGAACGTTTTCTCCCACCAGCTGCCCCGAATGCCAAAAGAATACATCACACGGCT
CGTCTTTGACCCGAAACACAAAACCCTTGCTTTAATTAAAGATGGCCGTGTTATTGGTGGTATCTGTTTC
CGTATGTTCCCATCTCAAGGATTCACAGAGATTGTCTTCTGTGCTGTAACCTCAAATGAGCAAGTCAAGG
GCTATGGAACACACCTGATGAATCATTTGAAAGAATATCACATAAAGCATGACATCCTGAACTTCCTCAC
ATATGCAGATGAATATGCAATTGGATACTTTAAGAAACAGGGTTTCTCCAAAGAAATTAAAATACCTAAA
ACCAAATATGTTGGCTATATCAAGGATTATGAAGGAGCCACTTTAATGGGATGTGAGCTAAATCCACGGA
TCCCGTACACAGAATTTTCTGTCATCATTAAAAAGCAGAAGGAGATAATTAAAAAACTGATTGAAAGAAA
ACAGGCACAAATTCGAAAAGTTTACCCTGGACTTTCATGTTTTAAAGATGGAGTTCGACAGATTCCTATA
GAAAGCATTCCTGGAATTAGAGAGACAGGCTGGAAACCGAGTGGAAAAGAGAAAAGTAAAGAGCCCAGAG
ACCCTGACCAGCTTTACAGCACGCTCAAGAGCATCCTCCAGCAGGTGAAGAGCCATCAAAGCGCTTGGCC
CTTCATGGAACCTGTGAAGAGAACAGAAGCTCCAGGATATTATGAAGTTATAAGGTTCCCCATGGATCTG
AAAACCATGAGTGAACGCCTCAAGAATAGGTACTACGTGTCTAAGAAATTATTCATGGCAGACTTACAGC
GAGTCTTTACCAATTGCAAAGAGTACAACCCCCCTGAGAGTGAATACTACAAATGTGCCAATATCCTGGA
GAAATTCTTCTTCAGTAAAATTAAGGAAGCTGGATTAATTGACAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC209821 representing NM_003884
Red=Cloning site Green=Tags(s)

MSEAGGAGPGGCGAGAGAGAGPGALPPQPAALPPAPPQGSPCAAAAGGSGACGPATAVAAAGTAEGPGGG
GSARIAVKKAQLRSAPRAKKLEKLGVYSACKAEESCKCNGWKNPNPSPTPPRADLQQIIVSLTESCRSCS
HALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKSILQRGKPVVEGSL
EKKPPFEKPSIEQGVNNFVQYKFSHLPAKERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKE
NYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFL
SMLEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSG
LEANPGEKRKMTDSHVLEEAKKPRVMGDIPMELINEVMSTITDPAAMLGPETNFLSAHSARDEAARLEER
RGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICF
RMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPK
TKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPI
ESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDL
KTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003884
ORF Size 2496 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003884.5
RefSeq Size 4838 bp
RefSeq ORF 2499 bp
Locus ID 8850
UniProt ID Q92831
Cytogenetics 3p24.3
Domains Acetyltransf, BROMO
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Notch signaling pathway
MW 92.8 kDa
Gene Summary CBP and p300 are large nuclear proteins that bind to many sequence-specific factors involved in cell growth and/or differentiation, including c-jun and the adenoviral oncoprotein E1A. The protein encoded by this gene associates with p300/CBP. It has in vitro and in vivo binding activity with CBP and p300, and competes with E1A for binding sites in p300/CBP. It has histone acetyl transferase activity with core histones and nucleosome core particles, indicating that this protein plays a direct role in transcriptional regulation. [provided by RefSeq, Jul 2008]
Other products for "KAT2B"
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.