GTF3C3 (NM_012086) Human Tagged ORF Clone

CAT#: RC208122

GTF3C3 (Myc-DDK-tagged)-Human general transcription factor IIIC, polypeptide 3, 102kDa (GTF3C3), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name GTF3C3 (NM_012086) Human Tagged ORF Clone
Symbol GTF3C3
Synonyms TFIIIC102; TFiiiC2-102; TFIIICgamma
Vector pCMV6-Entry
Sequence Data
>RC208122 representing NM_012086
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGGGTTCAGTCCGGAACTCATCGACTACTTGGAAGGGAAAATCTCCTTTGAGGAGTTCGAACGGC
GGAGAGAAGAGAGAAAAACCCGCGAGAAGAAAAGTCTTCAGGAAAAAGGCAAGTTATCAGCTGAAGAAAA
TCCCGATGACTCTGAAGTTCCATCATCATCAGGAATTAACTCTACCAAATCCCAAGACAAAGATGTCAAT
GAAGGAGAAACATCAGATGGAGTGAGGAAGTCAGTTCACAAGGTCTTTGCTTCCATGCTTGGAGAGAATG
AAGATGATGAGGAGGAAGAGGAAGAAGAGGAGGAGGAGGAGGAGGAGGAAGAAACACCTGAGCAACCCAC
TGCGGGCGATGTATTTGTATTGGAGATGGTTCTCAATCGTGAAACCAAGAAAATGATGAAAGAGAAAAGG
CCTCGGAGTAAACTTCCCAGAGCTCTGAGAGGTCTCATGGGTGAAGCCAACATTCGTTTTGCTCGAGGAG
AACGTGAAGAGGCGATATTGATGTGCATGGAAATCATAAGACAAGCTCCTCTGGCTTATGAGCCATTCTC
TACTCTAGCCATGATATATGAGGACCAAGGTGACATGGAAAAATCATTGCAGTTTGAGTTGATTGCTGCG
CATTTAAATCCCAGTGACACAGAAGAATGGGTTAGACTGGCAGAAATGTCTCTGGAACAAGACAATATTA
AGCAGGCTATTTTTTGCTATACAAAAGCTCTTAAATATGAACCTACTAATGTCCGTTATCTGTGGGAGCG
ATCAAGCCTTTATGAACAGATGGGTGATCATAAAATGGCCATGGATGGTTATAGGCGTATTTTAAACCTT
TTGTCTCCATCTGATGGCGAACGTTTTATGCAGCTGGCTAGAGATATGGCAAAGAGTTACTATGAAGCCA
ATGATGTTACTTCTGCTATTAACATAATTGATGAAGCTTTCTCAAAACACCAGGGCCTAGTCTCCATGGA
AGATGTTAACATAGCAGCTGAACTATATATTTCTAACAAACAGTATGACAAAGCTTTGGAGATAATTACA
GATTTTTCTGGAATTGTGCTGGAAAAAAAAACTTCAGAAGAAGGCACCTCAGAAGAGAATAAAGCTCCTG
AGAATGTTACCTGCACTATACCTGATGGCGTGCCAATAGATATCACAGTGAAGTTGATGGTCTGCCTTGT
ACATCTCAACATTCTTGAACCACTTAATCCTCTCTTGACAACACTAGTAGAACAGAATCCTGAAGATATG
GGAGACCTATACCTAGATGTTGCTGAAGCTTTTCTGGATGTTGGTGAATATAATTCTGCACTTCCCCTCC
TCAGTGCTCTTGTTTGCTCTGAAAGATACAACCTTGCAGTAGTTTGGCTTCGTCATGCAGAATGTTTAAA
GGCCTTAGGCTATATGGAGCGAGCTGCTGAAAGCTATGGCAAGGTGGTTGATCTGGCCCCACTCCATTTG
GATGCAAGGATTTCACTTTCTACCCTTCAGCAGCAGCTGGGCCAGCCTGAGAAAGCTCTGGAAGCTCTGG
AACCAATGTATGATCCAGATACTTTAGCACAGGATGCAAATGCTGCACAGCAGGAACTGAAGTTATTGCT
TCATCGTTCTACTCTGTTGTTTTCACAAGGCAAAATGTATGGTTATGTGGATACCTTACTTACTATGTTA
GCCATGCTTTTAAAGGTAGCAATGAATCGAGCCCAAGTTTGTTTGATATCCAGTTCCAAGTCTGGAGAGA
GGCATCTTTATCTTATTAAAGTATCGAGAGACAAAATATCAGACAGCAATGACCAAGAGTCAGCAAATTG
TGATGCAAAAGCAATATTTGCTGTGCTCACAAGCGTCTTGACAAAGGATGACTGGTGGAATCTTCTGTTG
AAGGCCATATACTCCTTATGTGACCTATCCCGATTTCAAGAGGCTGAGTTGCTTGTAGATTCCTCATTGG
AATATTACTCATTTTATGATGACAGGCAAAAACGCAAAGAACTAGAATACTTTGGTCTGTCTGCTGCAAT
TCTGGACAAAAATTTCAGAAAGGCATACAACTATATCAGGATAATGGTAATGGAAAATGTCAATAAACCC
CAGCTCTGGAACATTTTCAATCAAGTTACCATGCACTCCCAAGATGTACGACATCATCGCTTCTGTCTCC
GTTTGATGCTGAAAAACCCAGAAAATCATGCCCTATGTGTCTTAAATGGACACAATGCATTTGTATCTGG
TAGTTTTAAGCATGCGCTTGGACAGTATGTGCAAGCCTTTCGCACTCACCCTGACGAACCTCTCTATAGC
TTCTGTATAGGCCTAACCTTTATTCATATGGCATCTCAGAAGTATGTGTTACGGAGACATGCTCTTATTG
TACAGGGCTTTTCCTTTCTTAATCGATACCTCAGTTTACGTGGGCCCTGCCAGGAATCATTCTACAATTT
GGGCCGTGGCCTTCATCAGTTGGGGCTGATTCATCTTGCAATCCACTATTATCAGAAGGCCCTGGAGCTC
CCTCCACTTGTGGTAGAGGGTATAGAACTTGACCAGTTAGACTTACGAAGAGATATTGCCTACAACTTGT
CTCTCATCTATCAGAGCAGTGGGAATACCGGAATGGCTCAAACGCTTTTGTATACCTATTGTTCTATA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208122 representing NM_012086
Red=Cloning site Green=Tags(s)

MSGFSPELIDYLEGKISFEEFERRREERKTREKKSLQEKGKLSAEENPDDSEVPSSSGINSTKSQDKDVN
EGETSDGVRKSVHKVFASMLGENEDDEEEEEEEEEEEEEEETPEQPTAGDVFVLEMVLNRETKKMMKEKR
PRSKLPRALRGLMGEANIRFARGEREEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAA
HLNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGDHKMAMDGYRRILNL
LSPSDGERFMQLARDMAKSYYEANDVTSAINIIDEAFSKHQGLVSMEDVNIAAELYISNKQYDKALEIIT
DFSGIVLEKKTSEEGTSEENKAPENVTCTIPDGVPIDITVKLMVCLVHLNILEPLNPLLTTLVEQNPEDM
GDLYLDVAEAFLDVGEYNSALPLLSALVCSERYNLAVVWLRHAECLKALGYMERAAESYGKVVDLAPLHL
DARISLSTLQQQLGQPEKALEALEPMYDPDTLAQDANAAQQELKLLLHRSTLLFSQGKMYGYVDTLLTML
AMLLKVAMNRAQVCLISSSKSGERHLYLIKVSRDKISDSNDQESANCDAKAIFAVLTSVLTKDDWWNLLL
KAIYSLCDLSRFQEAELLVDSSLEYYSFYDDRQKRKELEYFGLSAAILDKNFRKAYNYIRIMVMENVNKP
QLWNIFNQVTMHSQDVRHHRFCLRLMLKNPENHALCVLNGHNAFVSGSFKHALGQYVQAFRTHPDEPLYS
FCIGLTFIHMASQKYVLRRHALIVQGFSFLNRYLSLRGPCQESFYNLGRGLHQLGLIHLAIHYYQKALEL
PPLVVEGIELDQLDLRRDIAYNLSLIYQSSGNTGMAQTLLYTYCSI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_012086
ORF Size 2658 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_012086.1, NM_012086.2, NM_012086.3, NM_012086.4, NP_036218
RefSeq Size 2961
RefSeq ORF 2661
Locus ID 9330
Cytogenetics 2q33.1
Domains TPR
Protein Families Transcription Factors
MW 101.1 kDa
Gene Summary The protein encoded by this gene is part of the TFIIIC2 complex, which binds to the promoters of small nuclear and cytoplasmic RNA genes in order to recruit RNA polymerase III. The TFIIIC2 complex is composed of six subunits. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)