Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-TF3C3 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TF3C3. |
Rabbit Polyclonal Anti-GTF3C3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF3C3 antibody: synthetic peptide directed towards the N terminal of human GTF3C3. Synthetic peptide located within the following region: GKLSAEENPDDSEVPSSSGINSTKSQDKDVNEGETSDGVRKSVHKVFASM |
Rabbit Polyclonal Anti-GTF3C3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF3C3 antibody: synthetic peptide directed towards the N terminal of human GTF3C3. Synthetic peptide located within the following region: LQEKGKLSAEENPDDSEVPSSSGINSTKSQDKDVNEGETSDGVRKSVHKV |
Gtf3c3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
GTF3C3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GTF3C3 |
Active filters
Target Symbol
- GTF3C3