GTF3C3 Rabbit Polyclonal Antibody

CAT#: TA339449

Rabbit Polyclonal Anti-GTF3C3 Antibody

Product Images

WB Suggested Anti-GTF3C3 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1:62500; Positive Control: HepG2 cell lysateGTF3C3 is supported by BioGPS gene expression data to be expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GTF3C3 antibody: synthetic peptide directed towards the N terminal of human GTF3C3. Synthetic peptide located within the following region: GKLSAEENPDDSEVPSSSGINSTKSQDKDVNEGETSDGVRKSVHKVFASM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 101 kDa
• Gene Name: general transcription factor IIIC subunit 3
• Database Link:
  NP_036218
  Entrez Gene 9330 Human
  UniProt ID Q9Y5Q9
• Background: The protein encoded by this gene is part of the TFIIIC2 complex, which binds to the promoters of small nuclear and cytoplasmic RNA genes in order to recruit RNA polymerase III. The TFIIIC2 complex is composed of six subunits. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]
• Synonyms: TFiiiC2-102; TFIIIC102; TFIIICgamma
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Horse: 92%; Mouse: 92%; Bovine: 86%; Dog: 85%; Rat: 85%

Reference Data

• Protein Families: Transcription Factors