TBXAS1 (NM_001061) Human Tagged ORF Clone

CAT#: RC208028

Reviews ()
Write a review

TBXAS1 (Myc-DDK-tagged)-Human thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant 1



Reconstitution Protocol

USD 497.00

In Stock*

Size
    • 10 ug

Product images

Other products for "TBXAS1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TBXAS1
Synonyms BDPLT14; CYP5; CYP5A1; GHOSAL; THAS; TS; TXAS; TXS
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC208028 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGAAGCCTTGGGGTTTCTAAAATTGGAAGTGAATGGCCCCATGGTGACGGTGGCCCTGTCAGTGG
CTCTCTTGGCCCTCCTGAAATGGTACTCCACATCAGCATTCTCAAGACTGGAGAAGTTAGGCCTCAGACA
TCCCAAGCCTTCTCCTTTCATTGGAAACTTGACATTTTTCCGCCAGGGTTTTTGGGAAAGCCAAATGGAG
CTCAGAAAGCTGTATGGACCTCTGTGTGGGTACTATCTTGGTCGTCGGATGTTTATTGTTATTTCTGAGC
CAGACATGATCAAGCAGGTGTTGGTTGAGAACTTCAGTAACTTTACCAACAGAATGGCGTCGGGTTTGGA
GTTCAAGTCGGTAGCCGACAGCGTTCTGTTTTTACGTGACAAAAGATGGGAAGAGGTCAGAGGTGCCCTG
ATGTCTGCTTTCAGTCCTGAAAAGCTGAACGAGATGGTTCCCCTCATCAGCCAAGCCTGCGACCTTCTCC
TGGCTCATTTAAAACGCTATGCGGAATCTGGGGACGCATTTGACATCCAGAGGTGCTACTGCAATTACAC
CACAGATGTGGTTGCCAGCGTCGCCTTTGGCACCCCGGTGGACTCCTGGCAGGCCCCTGAGGATCCCTTT
GTGAAACACTGCAAGCGTTTCTTCGAATTCTGCATCCCCAGACCTATCCTGGTTTTACTCTTATCATTTC
CATCCATAATGGTCCCACTGGCCCGGATTTTGCCCAATAAGAACCGAGACGAACTGAATGGCTTTTTTAA
CAAACTCATTAGGAATGTGATTGCCTTGCGGGACCAGCAAGCTGCCGAAGAGAGGCGGAGAGACTTCCTC
CAAATGGTCCTGGATGCCCGACATTCTGCAAGTCCCATGGGCGTGCAAGACTTTGACATCGTCAGAGACG
TTTTCTCCTCTACTGGGTGCAAGCCGAACCCTTCCCGGCAACACCAGCCCAGCCCTATGGCCAGGCCTTT
GACTGTGGATGAGATTGTGGGCCAGGCCTTCATCTTCCTCATCGCTGGCTATGAAATCATCACCAACACA
CTTTCTTTTGCCACCTACCTACTGGCCACCAACCCTGACTGCCAAGAGAAGCTTCTGAGAGAGGTAGACG
TTTTTAAGGAGAAACACATGGCCCCTGAGTTCTGCAGCCTCGAGGAAGGCCTGCCCTATCTGGACATGGT
GATTGCAGAGACGCTGAGGATGTACCCGCCAGCTTTCAGATTCACACGGGAGGCAGCTCAGGACTGCGAG
GTGCTGGGGCAGCGCATCCCCGCAGGCGCTGTGCTAGAGATGGCCGTGGGTGCCCTGCACCATGACCCTG
AGCACTGGCCAAGCCCGGAGACCTTCAACCCTGAAAGGTTCACGGCTGAGGCCCGGCAGCAGCACCGGCC
CTTCACGTACCTGCCCTTCGGGGCCGGCCCACGGAGCTGCCTCGGGGTGCGTCTAGGGCTGCTTGAGGTC
AAGTTGACACTGCTCCACGTGCTGCACAAGTTCCGGTTCCAAGCCTGCCCTGAGACCCAGGTACCGCTGC
AGCTAGAATCCAAATCTGCCCTAGGTCCAAAAAATGGTGTCTATATCAAGATCGTATCCCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC208028 protein sequence
Red=Cloning site Green=Tags(s)

MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQME
LRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGAL
MSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPF
VKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFL
QMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNT
LSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCE
VLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEV
KLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001061
ORF Size 1602 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001061.4
RefSeq Size 2082 bp
RefSeq ORF 1602 bp
Locus ID 6916
UniProt ID P24557
Cytogenetics 7q34
Domains p450
Protein Families Druggable Genome, P450
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
MW 60.6 kDa
Gene Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.