alpha 1 Fetoprotein(AFP) (NM_001134) Human Tagged ORF Clone

CAT#: RC206622

AFP (Myc-DDK-tagged)-Human alpha-fetoprotein (AFP)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name alpha 1 Fetoprotein(AFP) (NM_001134) Human Tagged ORF Clone
Symbol AFP
Synonyms AFPD; FETA; HPAFP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC206622 representing NM_001134
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGTGGGTGGAATCAATTTTTTTAATTTTCCTACTAAATTTTACTGAATCCAGAACACTGCATAGAA
ATGAATATGGAATAGCTTCCATATTGGATTCTTACCAATGTACTGCAGAGATAAGTTTAGCTGACCTGGC
TACCATATTTTTTGCCCAGTTTGTTCAAGAAGCCACTTACAAGGAAGTAAGCAAAATGGTGAAAGATGCA
TTGACTGCAATTGAGAAACCCACTGGAGATGAACAGTCTTCAGGGTGTTTAGAAAACCAGCTACCTGCCT
TTCTGGAAGAACTTTGCCATGAGAAAGAAATTTTGGAGAAGTACGGACATTCAGACTGCTGCAGCCAAAG
TGAAGAGGGAAGACATAACTGTTTTCTTGCACACAAAAAGCCCACTCCAGCATCGATCCCACTTTTCCAA
GTTCCAGAACCTGTCACAAGCTGTGAAGCATATGAAGAAGACAGGGAGACATTCATGAACAAATTCATTT
ATGAGATAGCAAGAAGGCATCCCTTCCTGTATGCACCTACAATTCTTCTTTGGGCTGCTCGCTATGACAA
AATAATTCCATCTTGCTGCAAAGCTGAAAATGCAGTTGAATGCTTCCAAACAAAGGCAGCAACAGTTACA
AAAGAATTAAGAGAAAGCAGCTTGTTAAATCAACATGCATGTGCAGTAATGAAAAATTTTGGGACCCGAA
CTTTCCAAGCCATAACTGTTACTAAACTGAGTCAGAAGTTTACCAAAGTTAATTTTACTGAAATCCAGAA
ACTAGTCCTGGATGTGGCCCATGTACATGAGCACTGTTGCAGAGGAGATGTGCTGGATTGTCTGCAGGAT
GGGGAAAAAATCATGTCCTACATATGTTCTCAACAAGACACTCTGTCAAACAAAATAACAGAATGCTGCA
AACTGACCACGCTGGAACGTGGTCAATGTATAATTCATGCAGAAAATGATGAAAAACCTGAAGGTCTATC
TCCAAATCTAAACAGGTTTTTAGGAGATAGAGATTTTAACCAATTTTCTTCAGGGGAAAAAAATATCTTC
TTGGCAAGTTTTGTTCATGAATATTCAAGAAGACATCCTCAGCTTGCTGTCTCAGTAATTCTAAGAGTTG
CTAAAGGATACCAGGAGTTATTGGAGAAGTGTTTCCAGACTGAAAACCCTCTTGAATGCCAAGATAAAGG
AGAAGAAGAATTACAGAAATACATCCAGGAGAGCCAAGCATTGGCAAAGCGAAGCTGCGGCCTCTTCCAG
AAACTAGGAGAATATTACTTACAAAATGCGTTTCTCGTTGCTTACACAAAGAAAGCCCCCCAGCTGACCT
CGTCGGAGCTGATGGCCATCACCAGAAAAATGGCAGCCACAGCAGCCACTTGTTGCCAACTCAGTGAGGA
CAAACTATTGGCCTGTGGCGAGGGAGCGGCTGACATTATTATCGGACACTTATGTATCAGACATGAAATG
ACTCCAGTAAACCCTGGTGTTGGCCAGTGCTGCACTTCTTCATATGCCAACAGGAGGCCATGCTTCAGCA
GCTTGGTGGTGGATGAAACATATGTCCCTCCTGCATTCTCTGATGACAAGTTCATTTTCCATAAGGATCT
GTGCCAAGCTCAGGGTGTAGCGCTGCAAACGATGAAGCAAGAGTTTCTCATTAACCTTGTGAAGCAAAAG
CCACAAATAACAGAGGAACAACTTGAGGCTGTCATTGCAGATTTCTCAGGCCTGTTGGAGAAATGCTGCC
AAGGCCAGGAACAGGAAGTCTGCTTTGCTGAAGAGGGACAAAAACTGATTTCAAAAACTCGTGCTGCTTT
GGGAGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC206622 representing NM_001134
Red=Cloning site Green=Tags(s)

MKWVESIFLIFLLNFTESRTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDA
LTAIEKPTGDEQSSGCLENQLPAFLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQ
VPEPVTSCEAYEEDRETFMNKFIYEIARRHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVT
KELRESSLLNQHACAVMKNFGTRTFQAITVTKLSQKFTKVNFTEIQKLVLDVAHVHEHCCRGDVLDCLQD
GEKIMSYICSQQDTLSNKITECCKLTTLERGQCIIHAENDEKPEGLSPNLNRFLGDRDFNQFSSGEKNIF
LASFVHEYSRRHPQLAVSVILRVAKGYQELLEKCFQTENPLECQDKGEEELQKYIQESQALAKRSCGLFQ
KLGEYYLQNAFLVAYTKKAPQLTSSELMAITRKMAATAATCCQLSEDKLLACGEGAADIIIGHLCIRHEM
TPVNPGVGQCCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQK
PQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001134
ORF Size 1827 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001134.1, NM_001134.2, NP_001125
RefSeq Size 2032
RefSeq ORF 1830
Locus ID 174
Cytogenetics 4q13.3
Protein Families Secreted Protein, Druggable Genome
MW 68.68 kDa
Gene Summary This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)