ZNF259 (ZPR1) (NM_003904) Human Tagged ORF Clone

CAT#: RC205721

Reviews ()
Write a review

ZNF259 (Myc-DDK-tagged)-Human zinc finger protein 259 (ZNF259)



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "ZPR1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ZPR1
Synonyms GKAF; ZNF259
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC205721 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCCAGCGGGGCTGTGGAACCAGGGCCCCCGGGGGCTGCCGTCGCCCCGTCGCCCGCCCCGGCCC
CGCCGCCTGCCCCTGATCACCTGTTCCGGCCCATCAGCGCCGAGGACGAGGAGCAGCAGCCCACCGAGAT
CGAGTCGCTATGCATGAACTGTTACTGCAATGGCATGACGCGCCTCCTGCTCACCAAGATTCCCTTCTTC
AGAGAAATAATAGTGAGCTCCTTTTCCTGCGAGCACTGTGGCTGGAACAACACGGAGATCCAGTCGGCAG
GCAGGATCCAGGACCAGGGAGTGCGCTACACTTTGTCTGTCAGGGCTCTGGAGGACATGAACAGAGAAGT
GGTGAAGACTGACTCTGCTGCCACAAGGATTCCTGAGCTAGATTTTGAAATTCCTGCCTTTAGCCAGAAA
GGAGCTCTGACCACTGTTGAAGGATTGATCACCCGTGCTATCTCTGGCCTGGAGCAGGACCAGCCTGCAC
GAAGGGCAAACAAAGATGCTACAGCTGAAAGAATTGATGAGTTCATTGTCAAACTGAAGGAGCTAAAGCA
AGTAGCCTCCCCTTTCACTCTGATCATTGATGATCCCTCAGGGAACAGTTTTGTGGAAAACCCACATGCT
CCTCAGAAAGATGATGCCCTGGTGATCACACACTACAACCGGACCCGACAGCAGGAAGAGATGCTGGGGC
TTCAAGAAGAAGCACCAGCAGAGAAGCCAGAAGAGGAAGATCTCAGAAATGAAGTGCTCCAGTTCAGCAC
AAACTGCCCAGAATGCAATGCCCCCGCTCAGACCAACATGAAGCTAGTACAAATCCCTCACTTTAAGGAG
GTTATCATCATGGCTACCAACTGCGAGAACTGTGGGCATCGGACCAATGAGGTGAAATCTGGAGGAGCAG
TAGAACCCTTGGGCACCAGGATCACCCTCCACATCACAGATGCCTCAGATATGACCAGAGACCTCCTCAA
GTCTGAGACTTGCAGTGTGGAAATCCCAGAGCTAGAATTTGAACTGGGAATGGCAGTCCTCGGGGGCAAG
TTCACCACACTGGAAGGGCTGCTGAAAGACATCCGGGAACTGGTGACCAAAAATCCTTTCACACTGGGCG
ACAGTTCCAATCCTGGACAGACGGAGAGACTACAGGAGTTTAGCCAGAAGATGGACCAGATCATCGAAGG
TAACATGAAGGCCCACTTTATTATGGATGATCCAGCAGGAAACAGTTACTTGCAGAATGTGTATGCGCCT
GAAGATGATCCTGAGATGAAGGTGGAGCGTTACAAGCGCACCTTTGACCAAAATGAGGAGCTAGGGCTCA
ATGACATGAAGACAGAGGGCTATGAGGCAGGCCTGGCTCCGCAACGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC205721 protein sequence
Red=Cloning site Green=Tags(s)

MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIPFF
REIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQK
GALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHA
PQKDDALVITHYNRTRQQEEMLGLQEEAPAEKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKE
VIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGK
FTTLEGLLKDIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAP
EDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_003904
ORF Size 1377 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_003904.5
RefSeq Size 1810 bp
RefSeq ORF 1380 bp
Locus ID 8882
UniProt ID O75312
Cytogenetics 11q23.3
Domains Zpr1
MW 50.9 kDa
Gene Summary The protein encoded by this gene is found in the cytoplasm of quiescent cells but translocates to the nucleolus in proliferating cells. The encoded protein interacts with survival motor neuron protein (SMN1) to enhance pre-mRNA splicing and to induce neuronal differentiation and axonal growth. Defects in this gene or the SMN1 gene can cause spinal muscular atrophy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.