GLI1 (NM_005269) Human Tagged ORF Clone

CAT#: RC201110

GLI1 (Myc-DDK-tagged)-Human GLI family zinc finger 1 (GLI1), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 800.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GLI1 (NM_005269) Human Tagged ORF Clone
Symbol GLI1
Synonyms GLI; GLI
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC201110 representing NM_005269
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTCAACTCGATGACCCCACCACCAATCAGTAGCTATGGCGAGCCCTGCTGTCTCCGGCCCCTCCCCA
GTCAGGGGGCCCCCAGTGTGGGGACAGAAGGACTGTCTGGCCCGCCCTTCTGCCACCAAGCTAACCTCAT
GTCCGGCCCCCACAGTTATGGGCCAGCCAGAGAGACCAACAGCTGCACCGAGGGCCCACTCTTTTCTTCT
CCCCGGAGTGCAGTCAAGTTGACCAAGAAGCGGGCACTGTCCATCTCACCTCTGTCGGATGCCAGCCTGG
ACCTGCAGACGGTTATCCGCACCTCACCCAGCTCCCTCGTAGCTTTCATCAACTCGCGATGCACATCTCC
AGGAGGCTCCTACGGTCATCTCTCCATTGGCACCATGAGCCCATCTCTGGGATTCCCAGCCCAGATGAAT
CACCAAAAAGGGCCCTCGCCTTCCTTTGGGGTCCAGCCTTGTGGTCCCCATGACTCTGCCCGGGGTGGGA
TGATCCCACATCCTCAGTCCCGGGGACCCTTCCCAACTTGCCAGCTGAAGTCTGAGCTGGACATGCTGGT
TGGCAAGTGCCGGGAGGAACCCTTGGAAGGTGATATGTCCAGCCCCAACTCCACAGGCATACAGGATCCC
CTGTTGGGGATGCTGGATGGGCGGGAGGACCTCGAGAGAGAGGAGAAGCGTGAGCCTGAATCTGTGTATG
AAACTGACTGCCGTTGGGATGGCTGCAGCCAGGAATTTGACTCCCAAGAGCAGCTGGTGCACCACATCAA
CAGCGAGCACATCCACGGGGAGCGGAAGGAGTTCGTGTGCCACTGGGGGGGCTGCTCCAGGGAGCTGAGG
CCCTTCAAAGCCCAGTACATGCTGGTGGTTCACATGCGCAGACACACTGGCGAGAAGCCACACAAGTGCA
CGTTTGAAGGGTGCCGGAAGTCATACTCACGCCTCGAAAACCTGAAGACGCACCTGCGGTCACACACGGG
TGAGAAGCCATACATGTGTGAGCACGAGGGCTGCAGTAAAGCCTTCAGCAATGCCAGTGACCGAGCCAAG
CACCAGAATCGGACCCATTCCAATGAGAAGCCGTATGTATGTAAGCTCCCTGGCTGCACCAAACGCTATA
CAGATCCTAGCTCGCTGCGAAAACATGTCAAGACAGTGCATGGTCCTGACGCCAATGTGACCAAACGGCA
CCGTGGGGATGGCCCCCTGCCTCGGGCACCATCCATTTCTACAGTGGAGCCCAAGAGGGAGCGGGAAGGA
GGTCCCATCAGGGAGGAAAGCAGACTGACTGTGCCAGAGGGTGCCATGAAGCCACAGCCAAGCCCTGGGG
CCCAGTCATCCTGCAGCAGTGACCACTCCCCGGCAGGGAGTGCAGCCAATACAGACAGTGGTGTGGAAAT
GACTGGCAATGCAGGGGGCAGCACTGAAGACCTCTCCAGCTTGGACGAGGGACCTTGCATTGCTGGCACT
GGTCTGTCCACTCTTCGCCGCCTTGAGAACCTCAGGCTGGACCAGCTACATCAACTCCGGCCAATAGGGA
CCCGGGGTCTCAAACTGCCCAGCTTGTCCCACACCGGTACCACTGTGTCCCGCCGCGTGGGCCCCCCAGT
CTCTCTTGAACGCCGCAGCAGCAGCTCCAGCAGCATCAGCTCTGCCTATACTGTCAGCCGCCGCTCCTCC
CTGGCCTCTCCTTTCCCCCCTGGCTCCCCACCAGAGAATGGAGCATCCTCCCTGCCTGGCCTTATGCCTG
CCCAGCACTACCTGCTTCGGGCAAGATATGCTTCAGCCAGAGGGGGTGGTACTTCGCCCACTGCAGCATC
CAGCCTGGATCGGATAGGTGGTCTTCCCATGCCTCCTTGGAGAAGCCGAGCCGAGTATCCAGGATACAAC
CCCAATGCAGGGGTCACCCGGAGGGCCAGTGACCCAGCCCAGGCTGCTGACCGTCCTGCTCCAGCTAGAG
TCCAGAGGTTCAAGAGCCTGGGCTGTGTCCATACCCCACCCACTGTGGCAGGGGGAGGACAGAACTTTGA
TCCTTACCTCCCAACCTCTGTCTACTCACCACAGCCCCCCAGCATCACTGAGAATGCTGCCATGGATGCT
AGAGGGCTACAGGAAGAGCCAGAAGTTGGGACCTCCATGGTGGGCAGTGGTCTGAACCCCTATATGGACT
TCCCACCTACTGATACTCTGGGATATGGGGGACCTGAAGGGGCAGCAGCTGAGCCTTATGGAGCGAGGGG
TCCAGGCTCTCTGCCTCTTGGGCCTGGTCCACCCACCAACTATGGCCCCAACCCCTGTCCCCAGCAGGCC
TCATATCCTGACCCCACCCAAGAAACATGGGGTGAGTTCCCTTCCCACTCTGGGCTGTACCCAGGCCCCA
AGGCTCTAGGTGGAACCTACAGCCAGTGTCCTCGACTTGAACATTATGGACAAGTGCAAGTCAAGCCAGA
ACAGGGGTGCCCAGTGGGGTCTGACTCCACAGGACTGGCACCCTGCCTCAATGCCCACCCCAGTGAGGGG
CCCCCACATCCACAGCCTCTCTTTTCCCATTACCCCCAGCCCTCTCCTCCCCAATATCTCCAGTCAGGCC
CCTATACCCAGCCACCCCCTGATTATCTTCCTTCAGAACCCAGGCCTTGCCTGGACTTTGATTCCCCCAC
CCATTCCACAGGGCAGCTCAAGGCTCAGCTTGTGTGTAATTATGTTCAATCTCAACAGGAGCTACTGTGG
GAGGGTGGGGGCAGGGAAGATGCCCCCGCCCAGGAACCTTCCTACCAGAGTCCCAAGTTTCTGGGGGGTT
CCCAGGTTAGCCCAAGCCGTGCTAAAGCTCCAGTGAACACATATGGACCTGGCTTTGGACCCAACTTGCC
CAATCACAAGTCAGGTTCCTATCCCACCCCTTCACCATGCCATGAAAATTTTGTAGTGGGGGCAAATAGG
GCTTCACATAGGGCAGCAGCACCACCTCGACTTCTGCCCCCATTGCCCACTTGCTATGGGCCTCTCAAAG
TGGGAGGCACAAACCCCAGCTGTGGTCATCCTGAGGTGGGCAGGCTAGGAGGGGGTCCTGCCTTGTACCC
TCCTCCCGAAGGACAGGTATGTAACCCCCTGGACTCTCTTGATCTTGACAACACTCAGCTGGACTTTGTG
GCTATTCTGGATGAGCCCCAGGGGCTGAGTCCTCCTCCTTCCCATGATCAGCGGGGCAGCTCTGGACATA
CCCCACCTCCCTCTGGGCCCCCCAACATGGCTGTGGGCAACATGAGTGTCTTACTGAGATCCCTACCTGG
GGAAACAGAATTCCTCAACTCTAGTGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201110 representing NM_005269
Red=Cloning site Green=Tags(s)

MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETNSCTEGPLFSS
PRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGSYGHLSIGTMSPSLGFPAQMN
HQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLKSELDMLVGKCREEPLEGDMSSPNSTGIQDP
LLGMLDGREDLEREEKREPESVYETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELR
PFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAK
HQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDANVTKRHRGDGPLPRAPSISTVEPKREREG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSSLDEGPCIAGT
GLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLERRSSSSSSISSAYTVSRRSS
LASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGGTSPTAASSLDRIGGLPMPPWRSRAEYPGYN
PNAGVTRRASDPAQAADRPAPARVQRFKSLGCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDA
RGLQEEPEVGTSMVGSGLNPYMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQA
SYPDPTQETWGEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEG
PPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCNYVQSQQELLW
EGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYPTPSPCHENFVVGANR
ASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLGGGPALYPPPEGQVCNPLDSLDLDNTQLDFV
AILDEPQGLSPPPSHDQRGSSGHTPPPSGPPNMAVGNMSVLLRSLPGETEFLNSSA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005269
ORF Size 3318 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005269.1, NM_005269.2, NP_005260
RefSeq Size 3600
RefSeq ORF 3321
Locus ID 2735
Cytogenetics 12q13.3
Protein Families Stem cell relevant signaling - DSL/Notch pathway, ES Cell Differentiation/IPS, Adult stem cells, Cancer stem cells, Embryonic stem cells, Transcription Factors, Druggable Genome
Protein Pathways Hedgehog signaling pathway, Pathways in cancer, Basal cell carcinoma
MW 117.7 kDa
Gene Summary This gene encodes a member of the Kruppel family of zinc finger proteins. The encoded transcription factor is activated by the sonic hedgehog signal transduction cascade and regulates stem cell proliferation. The activity and nuclear localization of this protein is negatively regulated by p53 in an inhibitory loop. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (3)