Jak1 (BC031297) Mouse Tagged ORF Clone

CAT#: MR209619

  • TrueORF®

Jak1 (Myc-DDK-tagged) - Mouse Janus kinase 1 (cDNA clone MGC:37919 IMAGE:5102798)

  View "BC031297" in other vectors (6)

Interest in protein/lysate? Sumbit request here!

USD 68.00

USD 670.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Jak1 (BC031297) Mouse Tagged ORF Clone
Symbol Jak1
Synonyms MGC37919, C130039L05Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR209619 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCACCTCAAGAAGCAGATCCTGCGCACGGACAACATAAGCTTTGTGCTGAAACGATGCTGTCAGC
CTAAGCCTCGAGAAATCTCCAATCTGCTCGTAGCCACTAAGAAAGCCCAGGAGTGGCAGCCTGTCTACTC
CATGAGCCAGCTGAGCTTTGATCGGATCCTTAAGAAAGATATTATACAAGGTGAGCACCTTGGCAGAGGC
ACAAGAACACATATCTATTCTGGGACCCTGCTGGACTACAAGGATGAGGAAGGAATTGCTGAAGAGAAGA
AGATAAAAGTGATCCTCAAAGTCCTAGACCCCAGCCACCGGGACATCTCTCTGGCCTTCTTTGAGGCTGC
TAGCATGATGAGACAGGTTTCCCACAAACATATAGTGTACCTCTACGGCGTGTGTGTCCGAGATGTGGAA
AATATCATGGTGGAAGAGTTTGTGGAGGGGGGGCCGTTGGATCTCTTCATGCACCGGAAAAGTGATGCGC
TTACTACCCCCTGGAAGTTCAAGGTTGCCAAACAGCTGGCCAGTGCCCTGAGTTACTTGGAAGATAAAGA
CCTGGTTCATGGAAATGTGTGCACTAAAAACCTCCTTCTGGCCCGTGAGGGCATTGACAGTGACATTGGC
CCGTTCATCAAGCTTAGTGACCCTGGCATCCCAGTCTCTGTGCTGACCAGGCAAGAGTGCATAGAGCGAA
TCCCCTGGATCGCTCCTGAGTGTGTTGAAGACTCCAAGAACCTGAGTGTGGCTGCTGACAAGTGGAGCTT
TGGAACCACGCTCTGGGAAATCTGCTACAACGGAGAGATTCCTCTCAAAGACAAGACCCTCATTGAGAAA
GAGAGGTTTTATGAAAGCCGCTGCAGGCCTGTGACTCCATCTTGCAAGGAGCTAGCTGACCTCATGACTC
GCTGCATGAACTATGACCCCAACCAGAGACCCTTCTTCCGAGCCATCATGAGGGACATTAACAAGCTGGA
GGAGCAGAATCCAGACATTGTTTCAGAAAAGCAGCCAACAACAGAGGTGGACCCCACTCACTTTGAAAAG
CGGTTCCTGAAGAGGATTCGTGACTTGGGAGAGGGTCACTTTGGGAAGGTTGAGCTCTGCAGATATGATC
CTGAGGGAGACAACACAGGGGAGCAGGTAGCTGTCAAGTCCCTGAAGCCTGAGAGTGGAGGTAACCACAT
AGCTGATCTGAAGAAGGAGATAGAGATCTTACGGAACCTCTACCATGAGAACATTGTGAAGTACAAAGGA
ATCTGCATGGAAGACGGAGGCAATGGTATCAAGCTCATCATGGAGTTTCTGCCTTCGGGAAGCCTAAAGG
AGTATCTGCCAAAGAATAAGAACAAAATCAACCTCAAACAGCAGCTAAAATATGCCATCCAGATTTGTAA
GGGGATGGACTACTTGGGTTCTCGGCAATACGTTCACCGGGACTTAGCAGCAAGAAATGTCCTTGTTGAG
AGTGAGCATCAAGTGAAGATCGGAGACTTTGGTTTAACCAAAGCAATTGAAACCGATAAGGAGTACTACA
CAGTCAAGGACGACCGGGACAGCCCAGTGTTCTGGTACGCTCCGGAATGTTTAATCCAGTGTAAATTTTA
TATCGCCTCTGATGTCTGGTCTTTTGGAGTGACACTGCACGAGCTGCTCACTTACTGTGACTCAGATTTT
AGTCCCATGGCCTTGTTCCTGAAAATGATAGGCCCAACTCATGGCCAGATGACAGTGACACGGCTTGTGA
ATACTCTGAAAGAAGGAAAGCGTCTGCCATGTCCACCCAACTGTCCTGATGAGGTTTATCAGCTTATGAG
AAAATGCTGGGAATTCCAACCATCTAACCGGACAACTTTTCAGAACCTTATTGAAGGATTTGAAGCACTT
TTAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR209619 protein sequence
Red=Cloning site Green=Tags(s)

MNHLKKQILRTDNISFVLKRCCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDRILKKDIIQGEHLGRG
TRTHIYSGTLLDYKDEEGIAEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVE
NIMVEEFVEGGPLDLFMHRKSDALTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSDIG
PFIKLSDPGIPVSVLTRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEK
ERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKQPTTEVDPTHFEK
RFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKG
ICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVE
SEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDF
SPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEAL
LK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN BC031297
ORF Size 1899 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC031297
RefSeq Size 2365
RefSeq ORF 1898
Locus ID 16451
Cytogenetics 4 C6|4 46.19 cM
MW 72.7 kDa

Other Versions

Other products for "Jak1"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Order online and get additional $20 off!
40% off proteins and antibodies
68 Mouse Clones