Jak1 (BC031297) Mouse Tagged ORF Clone

CAT#: MG209619

  • TrueORF®

Jak1 (GFP-tagged) - Mouse Janus kinase 1 (cDNA clone MGC:37919 IMAGE:5102798)

  View "BC031297" in other vectors (6)

USD 790.00


Availability*
3 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Jak1 (BC031297) Mouse Tagged ORF Clone
Symbol Jak1
Synonyms MGC37919, C130039L05Rik
Vector pCMV6-AC-GFP
Sequence Data
>MG209619 representing BC031297
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACCACCTCAAGAAGCAGATCCTGCGCACGGACAACATAAGCTTTGTGCTGAAACGATGCTGTCAGC
CTAAGCCTCGAGAAATCTCCAATCTGCTCGTAGCCACTAAGAAAGCCCAGGAGTGGCAGCCTGTCTACTC
CATGAGCCAGCTGAGCTTTGATCGGATCCTTAAGAAAGATATTATACAAGGTGAGCACCTTGGCAGAGGC
ACAAGAACACATATCTATTCTGGGACCCTGCTGGACTACAAGGATGAGGAAGGAATTGCTGAAGAGAAGA
AGATAAAAGTGATCCTCAAAGTCCTAGACCCCAGCCACCGGGACATCTCTCTGGCCTTCTTTGAGGCTGC
TAGCATGATGAGACAGGTTTCCCACAAACATATAGTGTACCTCTACGGCGTGTGTGTCCGAGATGTGGAA
AATATCATGGTGGAAGAGTTTGTGGAGGGGGGGCCGTTGGATCTCTTCATGCACCGGAAAAGTGATGCGC
TTACTACCCCCTGGAAGTTCAAGGTTGCCAAACAGCTGGCCAGTGCCCTGAGTTACTTGGAAGATAAAGA
CCTGGTTCATGGAAATGTGTGCACTAAAAACCTCCTTCTGGCCCGTGAGGGCATTGACAGTGACATTGGC
CCGTTCATCAAGCTTAGTGACCCTGGCATCCCAGTCTCTGTGCTGACCAGGCAAGAGTGCATAGAGCGAA
TCCCCTGGATCGCTCCTGAGTGTGTTGAAGACTCCAAGAACCTGAGTGTGGCTGCTGACAAGTGGAGCTT
TGGAACCACGCTCTGGGAAATCTGCTACAACGGAGAGATTCCTCTCAAAGACAAGACCCTCATTGAGAAA
GAGAGGTTTTATGAAAGCCGCTGCAGGCCTGTGACTCCATCTTGCAAGGAGCTAGCTGACCTCATGACTC
GCTGCATGAACTATGACCCCAACCAGAGACCCTTCTTCCGAGCCATCATGAGGGACATTAACAAGCTGGA
GGAGCAGAATCCAGACATTGTTTCAGAAAAGCAGCCAACAACAGAGGTGGACCCCACTCACTTTGAAAAG
CGGTTCCTGAAGAGGATTCGTGACTTGGGAGAGGGTCACTTTGGGAAGGTTGAGCTCTGCAGATATGATC
CTGAGGGAGACAACACAGGGGAGCAGGTAGCTGTCAAGTCCCTGAAGCCTGAGAGTGGAGGTAACCACAT
AGCTGATCTGAAGAAGGAGATAGAGATCTTACGGAACCTCTACCATGAGAACATTGTGAAGTACAAAGGA
ATCTGCATGGAAGACGGAGGCAATGGTATCAAGCTCATCATGGAGTTTCTGCCTTCGGGAAGCCTAAAGG
AGTATCTGCCAAAGAATAAGAACAAAATCAACCTCAAACAGCAGCTAAAATATGCCATCCAGATTTGTAA
GGGGATGGACTACTTGGGTTCTCGGCAATACGTTCACCGGGACTTAGCAGCAAGAAATGTCCTTGTTGAG
AGTGAGCATCAAGTGAAGATCGGAGACTTTGGTTTAACCAAAGCAATTGAAACCGATAAGGAGTACTACA
CAGTCAAGGACGACCGGGACAGCCCAGTGTTCTGGTACGCTCCGGAATGTTTAATCCAGTGTAAATTTTA
TATCGCCTCTGATGTCTGGTCTTTTGGAGTGACACTGCACGAGCTGCTCACTTACTGTGACTCAGATTTT
AGTCCCATGGCCTTGTTCCTGAAAATGATAGGCCCAACTCATGGCCAGATGACAGTGACACGGCTTGTGA
ATACTCTGAAAGAAGGAAAGCGTCTGCCATGTCCACCCAACTGTCCTGATGAGGTTTATCAGCTTATGAG
AAAATGCTGGGAATTCCAACCATCTAACCGGACAACTTTTCAGAACCTTATTGAAGGATTTGAAGCACTT
TTAAAA


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG209619 representing BC031297
Red=Cloning site Green=Tags(s)

MNHLKKQILRTDNISFVLKRCCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDRILKKDIIQGEHLGRG
TRTHIYSGTLLDYKDEEGIAEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVE
NIMVEEFVEGGPLDLFMHRKSDALTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSDIG
PFIKLSDPGIPVSVLTRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEK
ERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKQPTTEVDPTHFEK
RFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKG
ICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHRDLAARNVLVE
SEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSDF
SPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTTFQNLIEGFEAL
LK

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN BC031297
ORF Size 1898 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq BC031297
RefSeq Size 2365
RefSeq ORF 1898
Locus ID 16451
Cytogenetics 4 C6|4 46.19 cM

Other Versions

Other products for "Jak1"
Frequently bought together (2)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

USD 618.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

USD 299.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones