Gsg1l (NM_001101488) Mouse Tagged ORF Clone

CAT#: MG214180

Gsg1l (GFP-tagged) - Mouse GSG1-like (Gsg1l), (10ug)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 443.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gsg1l (NM_001101488) Mouse Tagged ORF Clone
Symbol Gsg1l
Synonyms AI852434; C230098I05Rik; g1l; G630023A01Rik; Gm637
Vector pCMV6-AC-GFP
Sequence Data
>MG214180 representing NM_001101488
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACGAGCCGCCGCGGCCGAGCGCTCCTGGCCGTGGCCTTGAACCTGCTGGCGCTGCTCTTCGCCA
CCACCGCCTTCCTCACCACGTACTGGTGCCAGGGCACGCAACGGGTGCCCAAGCCTGGCTGCGGCCAGGG
CGGCGGCGCCAACTGCCCCAACTCGGGCGCCAACGCCACGGCCAACAGCACAGCCGCCCCCGTCGCCGCG
AGCCCGGCCGGCGCGCCCTACAGCTGGGAGGCGGGCGACGAGCGCTTCCAGCTGCGCCGTTTCCACACTG
GCATCTGGTACTCGTGTGAGGAAGAGCTCGGTGGCCCGGGTGAGAAATGTCGCAGCTTCATTGACCTGGC
TCCAGCGTCAGAGAAAGGGGTGCTGTGGCTGTCGGTGGTCTCTGAGGTGCTCTACATCCTTCTGCTGGTG
GTCGGCTTCAGTCTCATGTGTCTTGAGCTCGTCCACTCCAGCAGCGTCATAGACGGGCTGAAGCTCAATG
CCTTTGCTGCGGTCTTCACGGTGCTCTCAGGTCTCCTGGGAATGGTCGCACACATGATGTACACACAGGT
GTTCCAGGTCACCGTGAGCCTTGGTCCTGAAGACTGGAGACCTCATTCCTGGGACTATGGGTGGTCCTTC
TGCTTGGCCTGGGGTTCATTTACCTGCTGCATGGCGGCATCTGTCACTACACTCAACTCCTATACCAAGA
CAGTCATTGAGTTCCGGCATAAGCGCAAGGTCTTTGAGCAAGGATACCGGGAGGAGCCGACGTTCATAGA
TCCTGAGGCCATCAAATACTTCCGGGAGAGGATTGAGAAGGGGGACGTGAGTGAAGAGGAAGACTTCCGC
CTTGCCTGCCGCCACGAGAGATACCCGACCCGGCACCAGCCACACATGGGAGACTCCTGGCCACGGAGCT
CAGCTCACGAGGCAGCAGAGCTAAACCGTCAGTGCTGGGTCCTGGGGCACTGGGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG214180 representing NM_001101488
Red=Cloning site Green=Tags(s)

MKTSRRGRALLAVALNLLALLFATTAFLTTYWCQGTQRVPKPGCGQGGGANCPNSGANATANSTAAPVAA
SPAGAPYSWEAGDERFQLRRFHTGIWYSCEEELGGPGEKCRSFIDLAPASEKGVLWLSVVSEVLYILLLV
VGFSLMCLELVHSSSVIDGLKLNAFAAVFTVLSGLLGMVAHMMYTQVFQVTVSLGPEDWRPHSWDYGWSF
CLAWGSFTCCMAASVTTLNSYTKTVIEFRHKRKVFEQGYREEPTFIDPEAIKYFRERIEKGDVSEEEDFR
LACRHERYPTRHQPHMGDSWPRSSAHEAAELNRQCWVLGHWV

TRTRRLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001101488
ORF Size 966 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001101488.1, NP_001094958
RefSeq Size 3924
RefSeq ORF 969
Locus ID 269994
Cytogenetics 7|7 F3
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (2)