Git1 (NM_001004144) Mouse Tagged ORF Clone

CAT#: MG210556

Git1 (GFP-tagged) - Mouse G protein-coupled receptor kinase-interactor 1 (Git1)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 1,082.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Git1 (NM_001004144) Mouse Tagged ORF Clone
Symbol Git1
Synonyms Cat-1; p95Cat
Vector pCMV6-AC-GFP
Sequence Data
>MG210556 representing NM_001004144
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCCGGAAGGGGCCGCGAGCGGAGGTGTGTGCGGACTGCAGCGCTCCGGACCCTGGCTGGGCATCTA
TCAGCAGAGGTGTGCTGGTTTGTGACGAGTGCTGCAGTGTGCACCGGAGCCTGGGACGACACATCTCCAT
TGTCAAGCACCTGCGCCACAGCGCCTGGCCTCCTACGCTGCTCCAGATGGTGCACACGCTTGCCAGCAAC
GGGGCCAACTCCATCTGGGAGCACTCCCTGCTGGACCCTGCGCAAGTGCAAAGTGGCCGGCGCAAAGCCA
ACCCCCAAGATAAAGTCCACCCCATCAAGTCAGAGTTCATCAGGGCAAAGTACCAGATGCTGGCGTTCGT
GCACAAGCTTCCCTGCCGTGATGATGATGGGGTCACCGCCAAAGACCTCAGCAAGCAACTGCACTCAAGT
GTGCGAACAGGCAACTTGGAAACATGTCTGCGCCTGCTTTCCTTGGGTGCCCAGGCCAACTTTTTTCACC
CAGAAAAGGGCACTACACCTCTACATGTGGCTGCCAAGGCAGGGCAGACACTGCAGGCTGAGCTGCTGGT
AGTGTATGGGGCTGACCCCGGGTCTCCTGATGTCAATGGCCGCACACCCATCGACTATGCCAGGCAGGCG
GGGCACCATGAACTGGCAGAAAGGCTAGTTGAGTGCCAGTATGAGCTCACTGACCGGTTGGCCTTCTATC
TCTGTGGACGAAAGCCTGATCACAAGAATGGGCATTACATCATCCCACAGATGGCTGACAGATCTCGGCA
AAAGTGCATGTCTCAGAGCTTGGATCTGTCTGAATTGGCCAAAGCTGCCAAGAAGAAGCTGCAAGCGCTC
AGCAACCGGCTTTTTGAGGAACTTGCCATGGATGTGTATGATGAGGTGGATCGGAGAGAAAATGATGCTG
TGTGGCTAGCTACCCAAAATCATAGCACCCTGGTGACGGAGCGCAGTGCTGTGCCCTTCCTGCCAGTCAA
CCCTGAATACTCAGCCACTCGGAATCAGGGACGACAGAAATTGGCCCGTTTCAATGCCCGAGAGTTTGCC
ACCTTGATCATCGACATTCTCAGTGAGGCCAAACGGAGGCAGCAGGGCAAGAGTCTAAGCAGCCCCACAG
ACAACCTTGAGCTGTCTGCACGGAGCCAGAGCGAGCTGGATGACCAGCACGACTACGACAGCGTGGCTTC
CGACGAAGACACGGACCAGGAGCCCTTGCCCAGTGCAGGCGCCACGCGGAACAACCGTGCCAGGAGCATG
GACTCCTCAGATCTGTCAGATGGGGCAGTGACACTGCAGGAGTACCTGGAGCTGAAGAAGGCTCTGGCTA
CCTCCGAGGCCAAGGTGCAACAGCTCATGAAGGTCAACAGCAGCCTGAGTGACGAGCTGCGGCGGCTGCA
AAGGGAGATCCACAAATTGCAGGCAGAGAACCTGCAGCTTCGGCAGCCACCCGGACCAGTGCCTCCACCC
TCACTTCCCAGTGAACGGGCAGAACACACCCTCATGGGGCCTGGTGGAAGCACCCACCGCAGGGACCGCC
AGGCCTTCTCTATGTATGAGCCAGGCTCTGCATTGAAGCCCTTTGGAGGTACACCTGGGGACGAGCTCGC
CACCCGGCTCCAGCCTTTCCACAGCACGGAGCTCGAAGACGATGCCATCTACTCAGTGCATGTCCCTGCC
GGCCTTTATCGGATCCGGAAGGGGGTGTCTGCCTCTTCTGTGCCCTTCACTCCCTCCTCCCCACTGCTGT
CGTGCTCCCAAGAAGGAAGTCGCCACGCGAGCAAGCTCTCACGCCACGGCAGTGGTGCGGACAGTGACTA
TGAGAACACACAGAGTGGGGACCCTCTGCTTGGGCTTGAAGGGAAGCGATTCCTAGAGCTGAGCAAGGAG
GATGAGCTGCACCCTGAGCTGGAGAGCTTAGATGGAGACCTCGACCCCGGGCTCCCCAGCACCGAAGACG
TCATCCTAAAGACAGAGCAGGTCACCAAGAACATTCAGGAACTATTGCGGGCAGCCCAGGAGTTCAAACA
TGACAGCTTTGTACCCTGTTCAGAAAAGATACATTTGGCTGTGACTGAGATGGCTTCTCTCTTCCCAAAG
AGGCCAGCCCTGGAGCCTGTGCGCAGTTCACTGCGGCTGCTCAACGCCAGCGCCTACCGGCTTCAGAGCG
AGTGCCGGAAGACAGTGCCTCCAGAGCCGGGCGCCCCTGTGGACTTCCAGCTGCTGACTCAGCAGGTGAT
CCAGTGCGCCTATGACATCGCCAAGGCTGCCAAGCAGCTGGTCACCATCACCACCCGAGAGAAGAAACAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG210556 representing NM_001004144
Red=Cloning site Green=Tags(s)

MSRKGPRAEVCADCSAPDPGWASISRGVLVCDECCSVHRSLGRHISIVKHLRHSAWPPTLLQMVHTLASN
GANSIWEHSLLDPAQVQSGRRKANPQDKVHPIKSEFIRAKYQMLAFVHKLPCRDDDGVTAKDLSKQLHSS
VRTGNLETCLRLLSLGAQANFFHPEKGTTPLHVAAKAGQTLQAELLVVYGADPGSPDVNGRTPIDYARQA
GHHELAERLVECQYELTDRLAFYLCGRKPDHKNGHYIIPQMADRSRQKCMSQSLDLSELAKAAKKKLQAL
SNRLFEELAMDVYDEVDRRENDAVWLATQNHSTLVTERSAVPFLPVNPEYSATRNQGRQKLARFNAREFA
TLIIDILSEAKRRQQGKSLSSPTDNLELSARSQSELDDQHDYDSVASDEDTDQEPLPSAGATRNNRARSM
DSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAENLQLRQPPGPVPPP
SLPSERAEHTLMGPGGSTHRRDRQAFSMYEPGSALKPFGGTPGDELATRLQPFHSTELEDDAIYSVHVPA
GLYRIRKGVSASSVPFTPSSPLLSCSQEGSRHASKLSRHGSGADSDYENTQSGDPLLGLEGKRFLELSKE
DELHPELESLDGDLDPGLPSTEDVILKTEQVTKNIQELLRAAQEFKHDSFVPCSEKIHLAVTEMASLFPK
RPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVDFQLLTQQVIQCAYDIAKAAKQLVTITTREKKQ

TRTRRLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag TurboGFP
ACCN NM_001004144
ORF Size 2310 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001004144.1, NP_001004144
RefSeq Size 3670
RefSeq ORF 2313
Locus ID 216963
Cytogenetics 11|11 B5
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)